KEGG   Homo sapiens (human): 1627Help
Entry
1627              CDS       T01001                                 

Gene name
DBN1, D0S117E
Definition
(RefSeq) drebrin 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.3
AA seq 649 aa AA seqDB search
MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFEN
QKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASS
VEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQF
WEQAKKEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEHRRKQQ
TLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAAAIIAQRPDNPREFFKQQERV
ASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVT
SSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAED
LMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWP
GNGEGASTLQGEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPP
ATFCDPEEVEGEPLAAPQTPTLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQ
SQEEEFAQSEELCAKAPPPVFYNKPPEIDITCWDADPVPEEEEGFEGGD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgtcagcttcagcggccaccgcctggagctgctggcggcttacgaggaggtg
atccgagaggagagcgcggccgactgggctctgtacacatatgaagatggctccgatgac
ctcaagcttgcagcatcaggagaagggggcttgcaggagctttcgggacactttgagaac
cagaaggtgatgtacggcttctgcagtgtcaaggactcccaagctgctctgccaaaatac
gtgctcatcaactgggtgggcgaagatgtgcctgatgcccgcaagtgcgcttgtgccagc
cacgtggctaaggtggcggagttcttccagggtgtcgacgtgatcgtgaacgccagcagc
gtggaagacatagacgcgggtgccatcgggcagcggctctctaacgggctggcgcgactc
tccagccctgtgctgcaccgactgcggctgcgagaggatgagaacgcagagcccgtgggc
accacctaccagaagacggatgcagctgtggaaatgaagcggattaaccgagagcagttc
tgggagcaggccaagaaggaagaagagctgcggaaggaggaggagcggaagaaggccctg
gatgagaggctcaggttcgagcaggagcggatggagcaggagcggcaggagcaagaggag
cgcgagcggcgctaccgggagcgggagcagcagatcgaggagcacaggaggaaacagcag
actttagaagcggaagaggccaagaggcggttgaaggagcagtctatctttggtgaccat
cgggatgaggaggaagagacccacatgaagaagtcagagtcggaggtggaggaggcagca
gctattattgcccagcggcctgacaacccaagggagttcttcaagcagcaggaaagagtc
gcatcggcctctgcgggcagctgtgatgtaccctcgcccttcaaccatcgaccaggcagc
cacctggacagccaccggaggatggcgcccactcccatccccacgcggagcccgtctgac
tccagcaccgcctccacccctgtcgctgagcagatagagcgggccctggatgaggtcacc
tcctcgcagcctccaccactgccaccgccacccccaccagcccaagagacccaggagccc
agccccatcctagacagtgaggagaccagagcagcagcccctcaggcctgggccggcccc
atggaggagccccctcaggcacaggcgcctccccgggggccaggcagccctgcagaggac
ttgatgttcatggagtctgcagagcaggctgtcctggctgctcccgtggagcctgccaca
gctgacgccacggagatccacgatgcagctgacaccattgaaactgacactgccactgct
gacaccactgttgccaacaacgtaccccccgccgccaccagcctcattgacctatggcct
ggcaacggggaaggggcctccacactccagggtgagcccagggcccccacgccaccctcg
ggtactgaggtcaccctggcagaggtgcccctgctggatgaggtggctccggagccactg
ctgccagcaggcgaaggctgtgccacccttctcaactttgatgagctgcctgagccgcca
gccaccttctgtgacccagaggaagtggaaggggagcccctggctgccccccagacccca
actctgccctcagcccttgaggagctggagcaagagcaggagccggagccccacctgcta
accaatggcgagaccacccagaaggaggggacccaggccagtgaggggtacttcagtcaa
tcacaggaggaggagtttgcccaatcggaagagctctgtgccaaggctccgcctcctgtg
ttctacaacaagcctccagagatcgacatcacatgctgggatgcagacccagttccagaa
gaggaggagggcttcgagggtggtgattag

DBGET integrated database retrieval system