KEGG   Homo sapiens (human): 1630Help
Entry
1630              CDS       T01001                                 

Gene name
DCC, CRC18, CRCR1, HGPPS2, IGDCC1, MRMV1, NTN1R1
Definition
(RefSeq) DCC netrin 1 receptor
  KO
K06765  
deleted in colorectal carcinoma
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Pathways in cancer
Colorectal cancer
Disease
H00020  
Colorectal cancer
H00044  
Cancer of the anal canal
H01287  
Congenital mirror movements (CMM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    1630 (DCC)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1630 (DCC)
   05210 Colorectal cancer
    1630 (DCC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P43146(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.2
AA seq 1447 aa AA seqDB search
MENSLRCVWVPKLAFVLFGASLFSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLD
CSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDL
TPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDL
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSAGK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS
KSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEH
SSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVK
TASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMASLEGLMKQLN
AITGSAF
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtcttagatgtgtttgggtacccaagctggcttttgtactcttcggagct
tccttgttcagcgcgcatcttcaagtaaccggttttcaaattaaagctttcacagcactg
cgcttcctctcagaaccttctgatgccgtcacaatgcggggaggaaatgtcctcctcgac
tgctccgcggagtccgaccgaggagttccagtgatcaagtggaagaaagatggcattcat
ctggccttgggaatggatgaaaggaagcagcaactttcaaatgggtctctgctgatacaa
aacatacttcattccagacaccacaagccagatgagggactttaccaatgtgaggcatct
ttaggagattctggctcaattattagtcggacagcaaaagttgcagtagcaggaccactg
aggttcctttcacagacagaatctgtcacagccttcatgggagacacagtgctactcaag
tgtgaagtcattggggagcccatgccaacaatccactggcagaagaaccaacaagacctg
actccaatcccaggtgactcccgagtggtggtcttgccctctggagcattgcagatcagc
cgactccaaccgggggacattggaatttaccgatgctcagctcgaaatccagccagctca
agaacaggaaatgaagcagaagtcagaattttatcagatccaggactgcatagacagctg
tattttctgcaaagaccatccaatgtagtagccattgaaggaaaagatgctgtcctggaa
tgttgtgtttctggctatcctccaccaagttttacctggttacgaggcgaggaagtcatc
caactcaggtctaaaaagtattctttattgggtggaagcaacttgcttatctccaatgtg
acagatgatgacagtggaatgtatacctgtgttgtcacatataaaaatgagaatattagt
gcctctgcagagctcacagtcttggttccgccatggtttttaaatcatccttccaacctg
tatgcctatgaaagcatggatattgagtttgaatgtacagtctctggaaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtcattcctagtgattattttcagatagtg
ggaggaagcaacttacggatacttggggtggtgaagtcagatgaaggcttttatcaatgt
gtggctgaaaatgaggctggaaatgcccagaccagtgcacagctcattgtccctaagcct
gctatcccaagctccagtgtcctcccttcggctcccagagatgtggtccctgtcttggtt
tccagccgatttgtccgtctcagctggcgcccacctgcagaagcgaaagggaacattcaa
actttcacggtctttttctccagagaaggtgacaacagggaacgagcattgaatacaaca
cagcctgggtcccttcagctcactgtgggaaacctgaagccagaagccatgtacaccttt
cgagttgtggcttacaatgaatggggaccgggagagagttctcaacccatcaaggtggcc
acacagcctgagttgcaagttccagggccagtagaaaacctgcaagctgtatctacctca
cctacctcaattcttattacctgggaaccccctgcctatgcaaacggtccagtccaaggt
tacagattgttctgcactgaggtgtccacaggaaaagaacagaatatagaggttgatgga
ctatcttataaactggaaggcctgaaaaaattcaccgaatatagtcttcgattcttagct
tataatcgctatggtccgggcgtctctactgatgatataacagtggttacactttctgac
gtgccaagtgccccgcctcagaacgtctccctggaagtggtcaattcaagaagtatcaaa
gttagctggctgcctcctccatcaggaacacaaaatggatttattaccggctataaaatt
cgacacagaaagacgacccgcaggggtgagatggaaacactggagccaaacaacctctgg
tacctattcacaggactggagaaaggaagtcagtacagtttccaggtgtcagccatgaca
gtcaatggtactggaccaccttccaactggtatactgcagagactccagagaatgatcta
gatgaatctcaagttcctgatcaaccaagctctcttcatgtgaggccccagactaactgc
atcatcatgagttggactcctcccttgaacccaaacatcgtggtgcgaggttatattatc
ggttatggcgttgggagcccttacgctgagacagtgcgtgtggacagcaagcagcgatat
tattccattgagaggttagagtcaagttcccattatgtaatctccctaaaagcttttaac
aatgccggagaaggagttcctctttatgaaagtgccaccaccaggtctataaccgatccc
actgacccagttgattattatcctttgcttgatgatttccccacctcggtcccagatctc
tccacccccatgctcccaccagtaggtgtacaggctgtggctcttacccatgatgctgtg
agggtcagctgggcagacaactctgtccctaagaaccaaaagacgtctgaggtgcgactt
tacaccgtccggtggagaaccagcttttctgcaagtgcaaaatacaagtcagaagacaca
acatctctaagttacacagcaacaggcctcaaaccaaacacaatgtatgaattctcggtc
atggtaacaaaaaacagaaggtccagtacttggagcatgactgcacatgccaccacgtat
gaagcagcccccacctctgctcccaaggacttgacagtcattactagggaagggaagcct
cgtgccgtcattgtgagttggcagcctcccttggaagccaatgggaaaattactgcttac
atcttattttataccttggacaagaacatcccaattgatgactggattatggaaacaatc
agtggtgataggcttactcatcaaatcatggatctcaaccttgatactatgtattacttt
cgaattcaagcacgaaattcaaaaggagtggggccactctctgatcctatcctcttcagg
actctgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatgga
ggttattggccagttgatactaatttgattgatagaagcaccctaaatgagccgccaatt
ggacaaatgcaccccccgcatggcagtgtcactcctcagaagaacagcaacctgcttgtg
atcattgtggtcaccgttggtgtcatcacagtgctggtagtggtcatcgtggctgtgatt
tgcacccgacgctcttcagcccagcagagaaagaaacgggccacccacagtgctggcaaa
aggaagggcagccagaaggacctccgaccccctgatctttggatccatcatgaagaaatg
gagatgaaaaatattgaaaagccatctggcactgaccctgcaggaagggactctcccatc
caaagttgccaagacctcacaccagtcagccacagccagtcagaaacccaactgggaagc
aaaagcacctctcattcaggtcaagacactgaggaagcagggagctctatgtccactctg
gagaggtcgctggctgcacgccgagccccccgggccaagctcatgattcccatggatgcc
cagtccaacaatcctgctgtcgtgagcgccatcccggtgccaacgctagaaagtgcccag
tacccaggaatcctcccgtctcccacctgtggatatccccacccgcagttcactctccgg
cctgtgccattcccaacactctcagtggaccgaggtttcggagcaggaagaagtcagtca
gtgagtgaaggaccaactacccaacaaccacctatgctgcccccatctcagcctgagcat
tctagcagcgaggaggcaccaagcagaaccatccccacagcttgtgttcgaccaactcac
ccactccgcagctttgctaatcctttgctacctccaccaatgagtgcaatagaaccgaaa
gtcccttacacaccacttttgtctcagccagggcccactcttcctaagacccatgtgaaa
acagcctcccttgggttggctggaaaagcaagatcccctttgcttcctgtgtctgtgcca
acagcccctgaagtgtctgaggagagccacaaaccaacagaggattcagccaatgtgtat
gaacaggatgatctgagtgaacaaatggcaagtttggaaggactcatgaagcagcttaat
gccatcacaggctcagccttttaa

DBGET integrated database retrieval system