KEGG   Homo sapiens (human): 1630Help
Entry
1630              CDS       T01001                                 

Gene name
DCC, CRC18, CRCR1, HGPPS2, IGDCC1, MRMV1, NTN1R1
Definition
(RefSeq) DCC netrin 1 receptor
  KO
K06765  deleted in colorectal carcinoma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Network
N00101  DCC-apoptotic pathway
N00102  Loss of DCC to DCC-apoptotic pathway
Disease
H00020  Colorectal cancer
H00044  Cancer of the anal canal
H01287  Congenital mirror movements (CMM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    1630 (DCC)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1630 (DCC)
   05210 Colorectal cancer
    1630 (DCC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 Interfer-bind EphA2_TM Herpes_gE Protocadherin FAM176 V-set_CD47 TMEM154 CD34_antigen DUF4998 Ly49
Motif
Other DBs
NCBI-GeneID: 1630
NCBI-ProteinID: NP_005206
OMIM: 120470
HGNC: 2701
Ensembl: ENSG00000187323
Vega: OTTHUMG00000132698
Pharos: P43146(Tbio)
UniProt: P43146 Q49AK4
Structure
PDB: 

Jmol
Position
18q21.2
AA seq 1447 aa AA seqDB search
MENSLRCVWVPKLAFVLFGASLFSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLD
CSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDL
TPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDL
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSAGK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS
KSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEH
SSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVK
TASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMASLEGLMKQLN
AITGSAF
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtcttagatgtgtttgggtacccaagctggcttttgtactcttcggagct
tccttgttcagcgcgcatcttcaagtaaccggttttcaaattaaagctttcacagcactg
cgcttcctctcagaaccttctgatgccgtcacaatgcggggaggaaatgtcctcctcgac
tgctccgcggagtccgaccgaggagttccagtgatcaagtggaagaaagatggcattcat
ctggccttgggaatggatgaaaggaagcagcaactttcaaatgggtctctgctgatacaa
aacatacttcattccagacaccacaagccagatgagggactttaccaatgtgaggcatct
ttaggagattctggctcaattattagtcggacagcaaaagttgcagtagcaggaccactg
aggttcctttcacagacagaatctgtcacagccttcatgggagacacagtgctactcaag
tgtgaagtcattggggagcccatgccaacaatccactggcagaagaaccaacaagacctg
actccaatcccaggtgactcccgagtggtggtcttgccctctggagcattgcagatcagc
cgactccaaccgggggacattggaatttaccgatgctcagctcgaaatccagccagctca
agaacaggaaatgaagcagaagtcagaattttatcagatccaggactgcatagacagctg
tattttctgcaaagaccatccaatgtagtagccattgaaggaaaagatgctgtcctggaa
tgttgtgtttctggctatcctccaccaagttttacctggttacgaggcgaggaagtcatc
caactcaggtctaaaaagtattctttattgggtggaagcaacttgcttatctccaatgtg
acagatgatgacagtggaatgtatacctgtgttgtcacatataaaaatgagaatattagt
gcctctgcagagctcacagtcttggttccgccatggtttttaaatcatccttccaacctg
tatgcctatgaaagcatggatattgagtttgaatgtacagtctctggaaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtcattcctagtgattattttcagatagtg
ggaggaagcaacttacggatacttggggtggtgaagtcagatgaaggcttttatcaatgt
gtggctgaaaatgaggctggaaatgcccagaccagtgcacagctcattgtccctaagcct
gctatcccaagctccagtgtcctcccttcggctcccagagatgtggtccctgtcttggtt
tccagccgatttgtccgtctcagctggcgcccacctgcagaagcgaaagggaacattcaa
actttcacggtctttttctccagagaaggtgacaacagggaacgagcattgaatacaaca
cagcctgggtcccttcagctcactgtgggaaacctgaagccagaagccatgtacaccttt
cgagttgtggcttacaatgaatggggaccgggagagagttctcaacccatcaaggtggcc
acacagcctgagttgcaagttccagggccagtagaaaacctgcaagctgtatctacctca
cctacctcaattcttattacctgggaaccccctgcctatgcaaacggtccagtccaaggt
tacagattgttctgcactgaggtgtccacaggaaaagaacagaatatagaggttgatgga
ctatcttataaactggaaggcctgaaaaaattcaccgaatatagtcttcgattcttagct
tataatcgctatggtccgggcgtctctactgatgatataacagtggttacactttctgac
gtgccaagtgccccgcctcagaacgtctccctggaagtggtcaattcaagaagtatcaaa
gttagctggctgcctcctccatcaggaacacaaaatggatttattaccggctataaaatt
cgacacagaaagacgacccgcaggggtgagatggaaacactggagccaaacaacctctgg
tacctattcacaggactggagaaaggaagtcagtacagtttccaggtgtcagccatgaca
gtcaatggtactggaccaccttccaactggtatactgcagagactccagagaatgatcta
gatgaatctcaagttcctgatcaaccaagctctcttcatgtgaggccccagactaactgc
atcatcatgagttggactcctcccttgaacccaaacatcgtggtgcgaggttatattatc
ggttatggcgttgggagcccttacgctgagacagtgcgtgtggacagcaagcagcgatat
tattccattgagaggttagagtcaagttcccattatgtaatctccctaaaagcttttaac
aatgccggagaaggagttcctctttatgaaagtgccaccaccaggtctataaccgatccc
actgacccagttgattattatcctttgcttgatgatttccccacctcggtcccagatctc
tccacccccatgctcccaccagtaggtgtacaggctgtggctcttacccatgatgctgtg
agggtcagctgggcagacaactctgtccctaagaaccaaaagacgtctgaggtgcgactt
tacaccgtccggtggagaaccagcttttctgcaagtgcaaaatacaagtcagaagacaca
acatctctaagttacacagcaacaggcctcaaaccaaacacaatgtatgaattctcggtc
atggtaacaaaaaacagaaggtccagtacttggagcatgactgcacatgccaccacgtat
gaagcagcccccacctctgctcccaaggacttgacagtcattactagggaagggaagcct
cgtgccgtcattgtgagttggcagcctcccttggaagccaatgggaaaattactgcttac
atcttattttataccttggacaagaacatcccaattgatgactggattatggaaacaatc
agtggtgataggcttactcatcaaatcatggatctcaaccttgatactatgtattacttt
cgaattcaagcacgaaattcaaaaggagtggggccactctctgatcctatcctcttcagg
actctgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatgga
ggttattggccagttgatactaatttgattgatagaagcaccctaaatgagccgccaatt
ggacaaatgcaccccccgcatggcagtgtcactcctcagaagaacagcaacctgcttgtg
atcattgtggtcaccgttggtgtcatcacagtgctggtagtggtcatcgtggctgtgatt
tgcacccgacgctcttcagcccagcagagaaagaaacgggccacccacagtgctggcaaa
aggaagggcagccagaaggacctccgaccccctgatctttggatccatcatgaagaaatg
gagatgaaaaatattgaaaagccatctggcactgaccctgcaggaagggactctcccatc
caaagttgccaagacctcacaccagtcagccacagccagtcagaaacccaactgggaagc
aaaagcacctctcattcaggtcaagacactgaggaagcagggagctctatgtccactctg
gagaggtcgctggctgcacgccgagccccccgggccaagctcatgattcccatggatgcc
cagtccaacaatcctgctgtcgtgagcgccatcccggtgccaacgctagaaagtgcccag
tacccaggaatcctcccgtctcccacctgtggatatccccacccgcagttcactctccgg
cctgtgccattcccaacactctcagtggaccgaggtttcggagcaggaagaagtcagtca
gtgagtgaaggaccaactacccaacaaccacctatgctgcccccatctcagcctgagcat
tctagcagcgaggaggcaccaagcagaaccatccccacagcttgtgttcgaccaactcac
ccactccgcagctttgctaatcctttgctacctccaccaatgagtgcaatagaaccgaaa
gtcccttacacaccacttttgtctcagccagggcccactcttcctaagacccatgtgaaa
acagcctcccttgggttggctggaaaagcaagatcccctttgcttcctgtgtctgtgcca
acagcccctgaagtgtctgaggagagccacaaaccaacagaggattcagccaatgtgtat
gaacaggatgatctgagtgaacaaatggcaagtttggaaggactcatgaagcagcttaat
gccatcacaggctcagccttttaa

DBGET integrated database retrieval system