KEGG   Homo sapiens (human): 163688Help
Entry
163688            CDS       T01001                                 

Gene name
CALML6, CAGLP
Definition
calmodulin-like 6
Orthology
K02183  
calmodulin
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Dopaminergic synapse
Olfactory transduction
Phototransduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Alzheimer's disease
Amphetamine addiction
Alcoholism
Pertussis
Tuberculosis
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    163688 (CALML6)
   04015 Rap1 signaling pathway
    163688 (CALML6)
   04020 Calcium signaling pathway
    163688 (CALML6)
   04070 Phosphatidylinositol signaling system
    163688 (CALML6)
   04022 cGMP - PKG signaling pathway
    163688 (CALML6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    163688 (CALML6)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    163688 (CALML6)
   04912 GnRH signaling pathway
    163688 (CALML6)
   04915 Estrogen signaling pathway
    163688 (CALML6)
   04921 Oxytocin signaling pathway
    163688 (CALML6)
   04916 Melanogenesis
    163688 (CALML6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    163688 (CALML6)
   04270 Vascular smooth muscle contraction
    163688 (CALML6)
  Digestive system
   04970 Salivary secretion
    163688 (CALML6)
   04971 Gastric acid secretion
    163688 (CALML6)
  Nervous system
   04728 Dopaminergic synapse
    163688 (CALML6)
   04720 Long-term potentiation
    163688 (CALML6)
   04722 Neurotrophin signaling pathway
    163688 (CALML6)
  Sensory system
   04744 Phototransduction
    163688 (CALML6)
   04740 Olfactory transduction
    163688 (CALML6)
   04750 Inflammatory mediator regulation of TRP channels
    163688 (CALML6)
  Environmental adaptation
   04713 Circadian entrainment
    163688 (CALML6)
 Human Diseases
  Cancers
   05214 Glioma
    163688 (CALML6)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    163688 (CALML6)
  Substance dependence
   05031 Amphetamine addiction
    163688 (CALML6)
   05034 Alcoholism
    163688 (CALML6)
  Infectious diseases
   05133 Pertussis
    163688 (CALML6)
   05152 Tuberculosis
    163688 (CALML6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     163688 (CALML6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   163688 (CALML6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.33
AA seq 181 aa AA seqDB search
MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEW
LMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFD
KEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLI
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcaacaagaaatctcactgcagccctggtgtcaccaccctgcagaatcctgt
cagacaaccaccgacatgacagagcgcctgtcggctgagcagatcaaggagtacaaggga
gtctttgagatgttcgacgaagagggcaacggggaggtgaagacgggggagctggagtgg
ctcatgagcctgctgggtatcaaccccaccaagagtgagctggcctcaatggccaaggat
gtggacagagacaacaaagggttcttcaactgcgatggtttcctggcactaatgggagtt
taccatgagaaggcccagaaccaggagagcgagctgagggcggcattccgtgtctttgac
aaagagggcaagggctacattgactggaacacactcaagtacgtgctaatgaacgcaggg
gagcccctcaacgaggtggaggcggagcagatgatgaaggaggccgacaaggatggggac
aggaccatcgactatgaggagtttgtggccatgatgacgggggagtccttcaagctgatc
cagtag

DBGET integrated database retrieval system