KEGG   Homo sapiens (human): 1641Help
Entry
1641              CDS       T01001                                 

Gene name
DCX, DBCN, DC, LISX, SCLH, XLIS
Definition
(RefSeq) doublecortin
  KO
K16579  
neuronal migration protein doublecortin
Organism
hsa  Homo sapiens (human)
Disease
H00268  
Lissencephaly (LIS)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Microtubule-associated proteins
     1641 (DCX)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     1641 (DCX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq22.3-q23
AA seq 365 aa AA seqDB search
MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRN
GDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELE
EGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPK
LVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLH
DFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGP
MRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDS
LGDSM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgattttggacactttgacgaaagagataagacatccaggaacatgcgaggc
tcccggatgaatgggttgcctagccccactcacagcgcccactgtagcttctaccgaacc
agaaccttgcaggcactgagtaatgagaagaaagccaagaaggtacgtttctaccgcaat
ggggaccgctacttcaaggggattgtgtacgctgtgtcctctgaccgttttcgcagcttt
gacgccttgctggctgacctgacgcgatctctgtctgacaacatcaacctgcctcaggga
gtgcgttacatttacaccattgatggatccaggaagatcggaagcatggatgaactggag
gaaggggaaagctatgtctgttcctcagacaacttctttaaaaaggtggagtacaccaag
aatgtcaatcccaactggtctgtcaacgtaaaaacatctgccaatatgaaagccccccag
tccttggctagcagcaacagtgcacaggccagggagaacaaggactttgtgcgccccaag
ctggttaccatcatccgcagtggggtgaagcctcggaaggctgtgcgtgtgcttctgaac
aagaagacagcccactcttttgagcaagtcctcactgatatcacagaagccatcaaactg
gagaccggggttgtcaaaaaactctacactctggatggaaaacaggtaacttgtctccat
gatttctttggtgatgatgatgtgtttattgcctgtggtcctgaaaaatttcgctatgct
caggatgatttttctctggatgaaaatgaatgccgagtcatgaagggaaacccatcagcc
acagctggcccaaaggcatccccaacacctcagaagacttcagccaagagccctggtcct
atgcgccgaagcaagtctccagctgactcaggtaacgaccaagacgcaaacggaacctcc
agcagccagctctctacccccaagtctaagcagtctcccatctctacgcccaccagtcct
ggcagcctccggaagcacaaggacctgtacctgcctctgtccttggatgactcggactcg
cttggtgattccatgtaa

DBGET integrated database retrieval system