KEGG   Homo sapiens (human): 1642Help
Entry
1642              CDS       T01001                                 

Gene name
DDB1, DDBA, UV-DDB1, XAP1, XPCE, XPE, XPE-BF
Definition
(RefSeq) damage specific DNA binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Module
hsa_M00385  Cul4-DDB1-DDB2 complex
hsa_M00386  Cul4-DDB1-CSA complex
Network
N00267  HBV HBx to host-cell-protein activation
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum (XP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1642 (DDB1)
  Replication and repair
   03420 Nucleotide excision repair
    1642 (DDB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1642 (DDB1)
  Infectious diseases
   05161 Hepatitis B
    1642 (DDB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     1642 (DDB1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      1642 (DDB1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      1642 (DDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MMS1_N CPSF_A Beta_propel
Motif
Other DBs
NCBI-GeneID: 1642
NCBI-ProteinID: NP_001914
OMIM: 600045
HGNC: 2717
Ensembl: ENSG00000167986
Vega: OTTHUMG00000168209
Pharos: Q16531(Tbio)
UniProt: Q16531
Structure
PDB: 

Jmol
Position
11q12.2
AA seq 1140 aa AA seqDB search
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacaactacgtggtaacggcccagaagcccaccgccgtgaacggctgcgtgacc
ggacactttacttcggccgaagacttaaacctgttgattgccaaaaacacgagattagag
atctatgtggtcaccgccgaggggcttcggcccgtcaaagaggtgggcatgtatgggaag
attgcggtcatggagcttttcaggcccaagggggagagcaaggacctgctgtttatcttg
acagcgaagtacaatgcctgcatcctggagtataaacagagtggcgagagcattgacatc
attacgcgagcccatggcaatgtccaggaccgcattggccgcccctcagagaccggcatt
attggcatcattgaccctgagtgccggatgattggcctgcgtctctatgatggccttttc
aaggttattccactagatcgcgataataaagaactcaaggccttcaacatccgcctggag
gagctgcatgtcattgatgtcaagttcctatatggttgccaagcacctactatttgcttt
gtctaccaggaccctcaggggcggcacgtaaaaacctatgaggtgtctctccgagaaaag
gaattcaataagggcccttggaaacaggaaaatgtcgaagctgaagcttccatggtgatc
gcagtcccagagccctttgggggggccatcatcattggacaggagtcaatcacctatcac
aatggtgacaaatacctggctattgcccctcctatcatcaagcaaagcacgattgtgtgc
cacaatcgagtggaccctaatggctcaagatacctgctgggagacatggaaggccggctc
ttcatgctgcttttggagaaggaggaacagatggatggcaccgtcactctcaaggatctc
cgtgtagaactccttggagagacctctattgctgagtgcttgacataccttgataatggt
gttgtgtttgtcgggtctcgcctgggtgactcccagcttgtgaagctcaacgttgacagt
aatgaacaaggctcctatgtagtggccatggaaacctttaccaacttaggacccattgtc
gatatgtgcgtggtggacctggagaggcaggggcaggggcagctggtcacttgctctggg
gctttcaaggaaggttctttgcggatcatccggaatggaattggaatccacgagcatgcc
agcattgacttaccaggcatcaaaggattatggccactgcggtctgaccctaatcgtgag
actgatgacactttggtgctctcttttgtgggccagacaagagttctcatgttaaatgga
gaggaggtagaagaaaccgaactgatgggtttcgtggatgatcagcagactttcttctgt
ggcaacgtggctcatcagcagcttatccagatcacttcagcatcggtgaggttggtctct
caagaacccaaagctctggtcagtgaatggaaggagcctcaggccaagaacatcagtgtg
gcctcctgcaatagcagccaggtggtggtggctgtaggcagggccctctactatctgcag
atccatcctcaggagctccggcagatcagccacacagagatggaacatgaagtggcttgc
ttggacatcaccccattaggagacagcaatggactgtcccctctttgtgccattggcctc
tggacggacatctcggctcgtatcttgaagttgccctcttttgaactactgcacaaggag
atgctgggtggagagatcattcctcgctccatcctgatgaccacctttgagagtagccat
tacctcctttgtgccttgggagatggagcgcttttctactttgggctcaacattgagaca
ggtctgttgagcgaccgtaagaaggtgactttgggcacccagcccaccgtattgaggact
tttcgttctctttctaccaccaacgtctttgcttgttctgaccgccccactgtcatctat
agcagcaaccacaaattggtcttctcaaatgtcaacctcaaggaagtgaactacatgtgt
cccctcaattcagatggctatcctgacagcctggcgctggccaacaatagcaccctcacc
attggcaccatcgatgagatccagaagctgcacattcgcacagttcccctctatgagtct
ccaaggaagatctgctaccaggaagtgtcccagtgtttcggggtcctctccagccgcatt
gaagtccaagacacgagtgggggcacgacagccttgaggcccagcgctagcacccaggct
ctgtccagcagtgtaagctccagcaagctgttctccagcagcactgctcctcatgagacc
tcctttggagaagaggtggaggtgcacaacctacttatcattgaccaacacacctttgaa
gtgcttcatgcccaccagtttctgcagaatgaatatgccctcagtctggtttcctgcaag
ctgggcaaagaccccaacacttacttcattgtgggcacagcaatggtgtatcctgaagag
gcagagcccaagcagggtcgcattgtggtctttcagtattcggatggaaaactacagact
gtggctgaaaaggaagtgaaaggggccgtgtactctatggtggaatttaacgggaagctg
ttagccagcatcaatagcacggtgcggctctatgagtggacaacagagaaggagctgcgc
actgagtgcaaccactacaacaacatcatggccctctacctgaagaccaagggcgacttc
atcctggtgggcgaccttatgcgctcagtgctgctgcttgcctacaagcccatggaagga
aactttgaagagattgctcgagactttaatcccaactggatgagtgctgtggaaatcttg
gatgatgacaattttctgggggctgaaaatgcctttaacttgtttgtgtgtcaaaaggat
agcgctgccaccactgacgaggagcggcagcacctccaggaggttggtcttttccacctg
ggcgagtttgtcaatgtcttttgccacggctctctggtaatgcagaatctgggtgagact
tccacccccacacaaggctcggtgctcttcggcacggtcaacggcatgatagggctggtg
acctcactgtcagagagctggtacaacctcctgctggacatgcagaatcgactcaataaa
gtcatcaaaagtgtggggaagatcgagcactccttctggagatcctttcacaccgagcgg
aagacagaaccagccacaggtttcatcgacggtgacttgattgagagtttcctggatatt
agccgccccaagatgcaggaggtggtggcaaacctacagtatgacgatggcagcggtatg
aagcgagaggccactgcagacgacctcatcaaggttgtggaggagctaactcggatccat
tag

DBGET integrated database retrieval system