KEGG   Homo sapiens (human): 1643Help
Entry
1643              CDS       T01001                                 

Gene name
DDB2, DDBB, UV-DDB2, XPE
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  
DNA damage-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
p53 signaling pathway
Ubiquitin mediated proteolysis
Hepatitis B
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Module
Cul4-DDB1-DDB2 complex
Disease
H00403  
Disorders of nucleotide excision repair
H01428  
Xeroderma pigmentosum (XP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1643 (DDB2)
  Replication and repair
   03420 Nucleotide excision repair
    1643 (DDB2)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    1643 (DDB2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1643 (DDB2)
   05210 Colorectal cancer
    1643 (DDB2)
   05212 Pancreatic cancer
    1643 (DDB2)
   05214 Glioma
    1643 (DDB2)
   05216 Thyroid cancer
    1643 (DDB2)
   05220 Chronic myeloid leukemia
    1643 (DDB2)
   05217 Basal cell carcinoma
    1643 (DDB2)
   05218 Melanoma
    1643 (DDB2)
   05213 Endometrial cancer
    1643 (DDB2)
   05224 Breast cancer
    1643 (DDB2)
   05222 Small cell lung cancer
    1643 (DDB2)
   05223 Non-small cell lung cancer
    1643 (DDB2)
  Infectious diseases
   05161 Hepatitis B
    1643 (DDB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     1643 (DDB2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      1643 (DDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92466(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 427 aa AA seqDB search
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtcccctggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggtggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccaactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccttatgaattgaggacgatcgacgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgaattc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacacggaagtga

DBGET integrated database retrieval system