KEGG   Homo sapiens (human): 1643Help
Entry
1643              CDS       T01001                                 

Gene name
DDB2, DDBB, UV-DDB2
Definition
damage-specific DNA binding protein 2, 48kDa
Orthology
K10140  
DNA damage-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
p53 signaling pathway
Ubiquitin mediated proteolysis
Hepatitis B
Module
Cul4-DDB1-DDB2 complex
Disease
H00403  
Disorders of nucleotide excision repair
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p12-p11
AA seq 427 aa AA seqDB search
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtcccctggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggtggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccaactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccttatgaattgaggacgatcgacgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgaattc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacacggaagtga

DBGET integrated database retrieval system