KEGG   Homo sapiens (human): 1644Help
Entry
1644              CDS       T01001                                 

Gene name
DDC, AADC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Module
hsa_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
hsa_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H01161  Aromatic L-amino acid decarboxylase (AADC) deficiency
Drug target
Benserazide (DG01296): D01653 D03082
Carbidopa: D00558
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    1644 (DDC)
   00360 Phenylalanine metabolism
    1644 (DDC)
   00380 Tryptophan metabolism
    1644 (DDC)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1644 (DDC)
   04726 Serotonergic synapse
    1644 (DDC)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    1644 (DDC)
   05031 Amphetamine addiction
    1644 (DDC)
   05034 Alcoholism
    1644 (DDC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     1644 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     1644 (DDC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1644 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1644
NCBI-ProteinID: NP_000781
OMIM: 107930
HGNC: 2719
Ensembl: ENSG00000132437
Vega: OTTHUMG00000023353
Pharos: P20711(Tclin)
UniProt: P20711 Q53Y41
Structure
PDB: 

Jmol
Position
7p12.2-p12.1
AA seq 480 aa AA seqDB search
MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaagtgaattccgaaggagagggaaggagatggtggattacgtggccaactac
atggaaggcattgagggacgccaggtctaccctgacgtggagcccgggtacctgcggccg
ctgatccctgccgctgcccctcaggagccagacacgtttgaggacatcatcaacgacgtt
gagaagataatcatgcctggggtgacgcactggcacagcccctacttcttcgcctacttc
cccactgccagctcgtacccggccatgcttgcggacatgctgtgcggggccattggctgc
atcggcttctcctgggcggcaagcccagcatgcacagagctggagactgtgatgatggac
tggctcgggaagatgctggaactaccaaaggcatttttgaatgagaaagctggagaaggg
ggaggagtgatccagggaagtgccagtgaagccaccctggtggccctgctggccgctcgg
accaaagtgatccatcggctgcaggcagcgtccccagagctcacacaggccgctatcatg
gagaagctggtggcttactcatccgatcaggcacactcctcagtggaaagagctgggtta
attggtggagtgaaattaaaagccatcccctcagatggcaacttcgccatgcgtgcgtct
gccctgcaggaagccctggagagagacaaagcggctggcctgattcctttctttatggtt
gccaccctggggaccacaacatgctgctcctttgacaatctcttagaagtcggtcctatc
tgcaacaaggaagacatatggctgcacgttgatgcagcctacgcaggcagtgcattcatc
tgccctgagttccggcaccttctgaatggagtggagtttgcagattcattcaactttaat
ccccacaaatggctattggtgaattttgactgttctgccatgtgggtgaaaaagagaaca
gacttaacgggagcctttagactggaccccacttacctgaagcacagccatcaggattca
gggcttatcactgactaccggcattggcagataccactgggcagaagatttcgctctttg
aaaatgtggtttgtatttaggatgtatggagtcaaaggactgcaggcttatatccgcaag
catgtccagctgtcccatgagtttgagtcactggtgcgccaggatccccgctttgaaatc
tgtgtggaagtcattctggggcttgtctgctttcggctaaagggttccaacaaagtgaat
gaagctcttctgcaaagaataaacagtgccaaaaaaatccacttggttccatgtcacctc
agggacaagtttgtcctgcgctttgccatctgttctcgcacggtggaatctgcccatgtg
cagcgggcctgggaacacatcaaagagctggcggccgacgtgctgcgagcagagagggag
tag

KEGG   DISEASE: Aromatic L-amino acid decarboxylase (AADC) deficiencyHelp
Entry
H01161                      Disease                                

Name
Aromatic L-amino acid decarboxylase (AADC) deficiency
Description
Aromatic L-amino acid decarboxylase (AADC) deficiency is an autosomal recessive disorders of monoamine neurotransmitter metabolism, clinically characterized by vegetative symptoms, oculogyric crises, dystonia, and severe neurologic dysfunction in infancy. Mutations in the gene encoding for the enzyme AADC (DDC) lead to a severe combined deficiency of serotonin and the two catecholamines dopamine and norepinephrine.
Category
Nervous system disease
Brite
Human diseases [BR:br08402]
 Nervous system diseases
  Other nervous and sensory system diseases
   H01161  Aromatic L-amino acid decarboxylase (AADC) deficiency
Human diseases in ICD-10 classification [BR:br08403]
 6. Diseases of the nervous system (G00-G99)
  G20-G26  Extrapyramidal and movement disorders
   G24  Dystonia
    H01161  Aromatic L-amino acid decarboxylase (AADC) deficiency
BRITE hierarchy
Pathway
hsa00350  Tyrosine metabolism
hsa00380  Tryptophan metabolism
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
Gene
DDC [HSA:1644] [KO:K01593]
Other DBs
ICD-10: G24.8
MeSH: C537437
OMIM: 608643
Reference
  Authors
Pons R, Ford B, Chiriboga CA, Clayton PT, Hinton V, Hyland K, Sharma R, De Vivo DC
  Title
Aromatic L-amino acid decarboxylase deficiency: clinical features, treatment, and prognosis.
  Journal
Neurology 62:1058-65 (2004)
DOI:10.1212/WNL.62.7.1058
Reference
  Authors
Brun L, Ngu LH, Keng WT, Ch'ng GS, Choy YS, Hwu WL, Lee WT, Willemsen MA, Verbeek MM, Wassenberg T, Regal L, Orcesi S, Tonduti D, Accorsi P, Testard H, Abdenur JE, Tay S, Allen GF, Heales S, Kern I, Kato M, Burlina A, Manegold C, Hoffmann GF, Blau N
  Title
Clinical and biochemical features of aromatic L-amino acid decarboxylase deficiency.
  Journal
Neurology 75:64-71 (2010)
DOI:10.1212/WNL.0b013e3181e620ae

» Japanese version

KEGG   DRUG: MethyldopaHelp
Entry
D00405                      Drug                                   

Name
Methyldopa (USP);
Methyldopa hydrate (JP17);
Aldomet (TN)
Product
  Generic
Formula
(C10H13NO4)2. 3H2O
Exact mass
476.2006
Mol weight
476.4749
Structure
Mol fileKCF fileDB searchJmolKegDraw
Simcomp SIMCOMP
Class
Cardiovascular agent
 DG01738  Centrally-acting antiadrenergic
 DG01456  Adrenergic receptor agonist
  DG01450  alpha-Adrenergic receptor agonist
   DG01449  alpha2-Adrenergic receptor agonist
    DG01655  alpha2-adrenergic receptor specific agonist
 DG01951  Catecholamine adrenergic receptor agonist
Other
 DG01617  Catecholamine synthesis inhibitors
Remark
Therapeutic category: 2145
ATC code: C02AB01
Chemical structure group: DG00248
Product (DG00248): D00405<JP/US>
Product (mixture): D10267<US>
Efficacy
Antihypertensive, alpha2-Adrenergic receptor agonist
  Disease
Hypertension [DS:H01633]
Comment
Dopamine derivative
Methyldopa is metabolited to alpha-Methylnorepinephrine which is agonist of alpha2 receptor.
Peripheral aromatic L-amino acid decarboxylase inhibitors (DCI)
Target
ADRA2 [HSA:150 151 152] [KO:K04138 K04139 K04140]
  Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Interaction
Drug interaction
Brite
Anatomical Therapeutic Chemical (ATC) classification [BR:br08303]
 C CARDIOVASCULAR SYSTEM
  C02 ANTIHYPERTENSIVES
   C02A ANTIADRENERGIC AGENTS, CENTRALLY ACTING
    C02AB Methyldopa
     C02AB01 Methyldopa (levorotatory)
      D00405  Methyldopa (USP) <JP/US>
USP drug classification [BR:br08302]
 Cardiovascular Agents
  Alpha-adrenergic Agonists
   Methyldopa
    D00405  Methyldopa (USP)
Therapeutic category of drugs in Japan [BR:br08301]
 2  Agents affecting individual organs
  21  Cardiovascular agents
   214  Antihypertensives
    2145  Methyldopas
     D00405  Methyldopa (USP); Methyldopa hydrate (JP17)
Target-based classification of drugs [BR:br08310]
 G Protein-coupled receptors
  Rhodopsin family
   Adrenaline
    ADRA2
     D00405  Methyldopa (USP) <JP/US>
Drugs listed in the Japanese Pharmacopoeia [BR:br08311]
 Chemicals
  D00405  Methyldopa hydrate
  D00405  Methyldopa tablets
Drug classes of therapeutic agents [br08360.html]
 Cardiovascular agents
  D00405
BRITE hierarchy
Other DBs
CAS: 41372-08-1
PubChem: 7847471
ChEMBL: CHEMBL1591707
DrugBank: DB00968
LigandBox: D00405
NIKKAJI: J244.493C
KCF data Show

ATOM        33
            1   C1d C    25.1300  -15.7500
            2   C6a C    26.3200  -15.0500
            3   C1b C    23.9400  -15.0500
            4   C1a C    24.6400  -17.1500
            5   N1a N    26.1100  -17.1500
            6   O6a O    27.5100  -15.7500
            7   O6a O    26.3200  -13.7200
            8   C8y C    22.7500  -15.7500
            9   C8x C    21.5600  -15.0500
            10  C8x C    22.7500  -17.1500
            11  C8y C    20.3700  -15.7500
            12  C8x C    21.5600  -17.7800
            13  C8y C    20.3700  -17.1500
            14  O1a O    19.1800  -15.0500
            15  O1a O    19.1800  -17.7800
            16  O0  O    32.5500  -15.9600
            17  C1d C    25.1300  -15.7500
            18  C6a C    26.3200  -15.0500
            19  O6a O    27.5100  -15.7500
            20  O6a O    26.3200  -13.7200
            21  C1b C    23.9400  -15.0500
            22  C8y C    22.7500  -15.7500
            23  C8x C    21.5600  -15.0500
            24  C8y C    20.3700  -15.7500
            25  C8y C    20.3700  -17.1500
            26  O1a O    19.1800  -17.7800
            27  C8x C    21.5600  -17.7800
            28  C8x C    22.7500  -17.1500
            29  O1a O    19.1800  -15.0500
            30  C1a C    24.6400  -17.1500
            31  N1a N    26.1100  -17.1500
            32  O0  O    32.5500  -15.9600
            33  O0  O    32.5500  -15.9600
BOND        30
            1     1   2 1
            2     1   3 1
            3     1   4 1 #Down
            4     1   5 1 #Up
            5     2   6 1
            6     2   7 2
            7     3   8 1
            8     8   9 1
            9     8  10 2
            10    9  11 2
            11   10  12 1
            12   11  13 1
            13   11  14 1
            14   13  15 1
            15   12  13 2
            16   17  18 1
            17   17  21 1
            18   17  30 1 #Down
            19   17  31 1 #Up
            20   18  19 1
            21   18  20 2
            22   21  22 1
            23   22  23 1
            24   22  28 2
            25   23  24 2
            26   28  27 1
            27   24  25 1
            28   24  29 1
            29   25  26 1
            30   27  25 2
BRACKET     1    17.9900  -18.8300   17.9900  -12.8100
            1    28.7000  -12.8100   28.7000  -18.8300
            1  2
 ORIGINAL  1    1   2   6   7   3   8   9  11  13  15  12  10  14   4   5
 REPEAT    1   17  18  19  20  21  22  23  24  25  26  27  28  29  30  31
            2    30.8000  -16.8700   30.8000  -15.0500
            2    32.9700  -15.0500   32.9700  -16.8700
            2  3
 ORIGINAL  2   16
 REPEAT    2   32  33

» Japanese version   » Back

KEGG   DRUG: CarbidopaHelp
Entry
D00558                      Drug                                   

Name
Carbidopa (USP);
Carbidopa hydrate (JP17);
Lodosyn (TN)
Product
  Generic
Formula
C10H14N2O4. H2O
Exact mass
244.1059
Mol weight
244.2444
Structure
Mol fileKCF fileDB searchJmolKegDraw
Simcomp SIMCOMP
Class
Neuropsychiatric agent
 DG01967  Antiparkinson agent
Other
 DG01617  Catecholamine synthesis inhibitors
Remark
Product: D00558<US>
Product (mixture): D00253<JP/US> D10293<JP/US>
Efficacy
Antiparkinsonian (potentiator), Decarboxylase inhibitor
  Disease
Parkinson's disease [DS:H00057]
Parkinsonism [DS:H01600]
Comment
Peripheral aromatic L-amino acid decarboxylase inhibitors (DCI)
Target
DDC [HSA:1644] [KO:K01593]
  Pathway
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
Interaction
Drug interaction
Structure map
map07057  Antiparkinsonian agents
Brite
USP drug classification [BR:br08302]
 Antiparkinson Agents
  Dopamine Precursors/L-Amino Acid Decarboxylase Inhibitors
   Carbidopa
    D00558  Carbidopa (USP)
Target-based classification of drugs [BR:br08310]
 Enzymes
  Lyases (EC4)
   Carboxy-lyases
    DDC
     D00558  Carbidopa (USP) <US>
Drugs listed in the Japanese Pharmacopoeia [BR:br08311]
 Chemicals
  D00558  Carbidopa hydrate
Drug classes of therapeutic agents [br08360.html]
 Neurological agents
  D00558
BRITE hierarchy
Other DBs
CAS: 38821-49-7
PubChem: 7847624
ChEBI: 3395
ChEMBL: CHEMBL1200748
DrugBank: DB00190
LigandBox: D00558
NIKKAJI: J244.502F
KCF data Show

ATOM        17
            1   O0  O    24.5218  -16.1191
            2   C8y C    14.0190  -16.1917
            3   C8y C    14.0190  -17.5936
            4   C8x C    15.2106  -18.2946
            5   C8x C    16.4723  -17.5936
            6   C8y C    16.4723  -16.1917
            7   C8x C    15.2106  -15.4907
            8   O1a O    12.8273  -15.4907
            9   O1a O    12.8273  -18.2946
            10  C1b C    17.6640  -15.4907
            11  C1d C    18.8556  -16.1917
            12  C6a C    20.0473  -15.4907
            13  O6a O    21.2389  -16.1917
            14  O6a O    20.0473  -14.0888
            15  N1b N    19.5556  -17.4041
            16  C1a C    17.8657  -17.1816
            17  N1a N    20.9298  -17.4046
BOND        16
            1     2   3 2
            2     3   4 1
            3     4   5 2
            4     5   6 1
            5     6   7 2
            6     2   7 1
            7     2   8 1
            8     3   9 1
            9     6  10 1
            10   10  11 1
            11   11  12 1
            12   12  13 1
            13   12  14 2
            14   11  15 1 #Up
            15   11  16 1 #Down
            16   15  17 1

» Japanese version   » Back

KEGG   DRUG: Benserazide hydrochlorideHelp
Entry
D01653                      Drug                                   

Name
Benserazide hydrochloride (JP17)
Formula
C10H15N3O5. HCl
Exact mass
293.0778
Mol weight
293.7041
Structure
Mol fileKCF fileDB searchJmolKegDraw
Simcomp SIMCOMP
Class
Neuropsychiatric agent
 DG01967  Antiparkinson agent
Other
 DG01617  Catecholamine synthesis inhibitors
Remark
Chemical structure group: DG01296
Product (mixture): D02135<JP>
Efficacy
Antiparkinsonian, Decarboxylase inhibitor
Comment
Peripheral aromatic L-amino acid decarboxylase inhibitors (DCI)
Target
DDC [HSA:1644] [KO:K01593]
  Pathway
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
Interaction
Drug interaction
Structure map
map07057  Antiparkinsonian agents
Brite
Target-based classification of drugs [BR:br08310]
 Enzymes
  Lyases (EC4)
   Carboxy-lyases
    DDC
     D01653  Benserazide hydrochloride (JP17)
Drugs listed in the Japanese Pharmacopoeia [BR:br08311]
 Chemicals
  D01653  Benserazide hydrochloride
BRITE hierarchy
Other DBs
CAS: 14919-77-8
PubChem: 7848716
ChEBI: 31262
ChEMBL: CHEMBL1255778
LigandBox: D01653
NIKKAJI: J369.099G
KCF data Show

ATOM        19
            1   C8y C    23.9725  -16.2472
            2   C8y C    23.9725  -17.6495
            3   C8x C    25.1899  -18.3506
            4   C8x C    26.4001  -17.6495
            5   C8y C    26.4001  -16.2472
            6   C8y C    25.1899  -15.5461
            7   O1a O    25.1916  -14.1437
            8   O1a O    22.7584  -15.5454
            9   O1a O    22.7584  -18.3513
            10  C1b C    27.6057  -15.5532
            11  N1b N    28.8168  -16.2543
            12  N1b N    30.0278  -15.5602
            13  C5a C    31.2389  -16.2613
            14  C1c C    32.4500  -15.5673
            15  C1b C    33.6610  -16.2685
            16  O1a O    34.8721  -15.5745
            17  O5a O    31.2359  -17.6636
            18  N1a N    32.4530  -14.1649
            19  X   Cl   34.9641  -18.5135
BOND        18
            1     2   9 1
            2     2   3 1
            3     5  10 1
            4     3   4 2
            5    10  11 1
            6     4   5 1
            7    11  12 1
            8     5   6 2
            9    12  13 1
            10    6   1 1
            11   13  14 1
            12   14  15 1
            13    6   7 1
            14   15  16 1
            15   13  17 2
            16    1   8 1
            17   14  18 1
            18    1   2 2

» Japanese version   » Back

KEGG   DRUG: BenserazideHelp
Entry
D03082                      Drug                                   

Name
Benserazide (USAN/INN)
Formula
C10H15N3O5
Exact mass
257.1012
Mol weight
257.2432
Structure
Mol fileKCF fileDB searchJmolKegDraw
Simcomp SIMCOMP
Class
Neuropsychiatric agent
 DG01967  Antiparkinson agent
Other
 DG01617  Catecholamine synthesis inhibitors
Remark
Chemical structure group: DG01296
Efficacy
Antiparkinsonian, Decarboxylase inhibitor
Comment
Peripheral aromatic L-amino acid decarboxylase inhibitors (DCI)
Target
DDC [HSA:1644] [KO:K01593]
  Pathway
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
Interaction
Drug interaction
Structure map
map07057  Antiparkinsonian agents
Brite
Target-based classification of drugs [BR:br08310]
 Enzymes
  Lyases (EC4)
   Carboxy-lyases
    DDC
     D03082  Benserazide (USAN/INN)
BRITE hierarchy
Other DBs
CAS: 322-35-0
PubChem: 17397237
ChEBI: 64187
ChEMBL: CHEMBL1096979
LigandBox: D03082
NIKKAJI: J276.221H
KCF data Show

ATOM        18
            1   C8y C    20.1225  -25.1372
            2   C8y C    20.1225  -26.5395
            3   C8x C    21.3399  -27.2406
            4   C8x C    22.5501  -26.5395
            5   C8y C    22.5501  -25.1372
            6   C8y C    21.3399  -24.4361
            7   O1a O    21.3416  -23.0337
            8   O1a O    18.9084  -24.4354
            9   O1a O    18.9084  -27.2413
            10  C1b C    23.7557  -24.4432
            11  N1b N    24.9668  -25.1443
            12  N1b N    26.1778  -24.4502
            13  C5a C    27.3889  -25.1513
            14  C1c C    28.6000  -24.4573
            15  C1b C    29.8110  -25.1585
            16  O1a O    31.0221  -24.4645
            17  O5a O    27.3859  -26.5536
            18  N1a N    28.6030  -23.0549
BOND        18
            1     2   9 1
            2     2   3 1
            3     5  10 1
            4     3   4 2
            5    10  11 1
            6     4   5 1
            7    11  12 1
            8     5   6 2
            9    12  13 1
            10    6   1 1
            11   13  14 1
            12   14  15 1
            13    6   7 1
            14   15  16 1
            15   13  17 2
            16    1   8 1
            17   14  18 1
            18    1   2 2

» Japanese version   » Back

KEGG   DRUG: MethyldopaHelp
Entry
D08205                      Drug                                   

Name
Methyldopa (INN);
Aldomet (TN)
Formula
C10H13NO4
Exact mass
211.0845
Mol weight
211.2145
Structure
Mol fileKCF fileDB searchJmolKegDraw
Simcomp SIMCOMP
Class
Cardiovascular agent
 DG01738  Centrally-acting antiadrenergic
 DG01456  Adrenergic receptor agonist
  DG01450  alpha-Adrenergic receptor agonist
   DG01449  alpha2-Adrenergic receptor agonist
    DG01655  alpha2-adrenergic receptor specific agonist
 DG01951  Catecholamine adrenergic receptor agonist
Other
 DG01617  Catecholamine synthesis inhibitors
Remark
Same as: C07194
ATC code: C02AB01
Chemical structure group: DG00248
Product (DG00248): D00405<JP/US>
Product (mixture): D10267<US>
Efficacy
Antihypertensive, alpha2-Adrenergic receptor agonist
Comment
Peripheral aromatic L-amino acid decarboxylase inhibitors (DCI)
Dopamine derivative
Target
ADRA2 [HSA:150 151 152] [KO:K04138 K04139 K04140]
  Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Interaction
Drug interaction
Brite
Anatomical Therapeutic Chemical (ATC) classification [BR:br08303]
 C CARDIOVASCULAR SYSTEM
  C02 ANTIHYPERTENSIVES
   C02A ANTIADRENERGIC AGENTS, CENTRALLY ACTING
    C02AB Methyldopa
     C02AB01 Methyldopa (levorotatory)
      D08205  Methyldopa (INN)
USP drug classification [BR:br08302]
 Cardiovascular Agents
  Alpha-adrenergic Agonists
   Methyldopa
    D08205  Methyldopa (INN)
Target-based classification of drugs [BR:br08310]
 G Protein-coupled receptors
  Rhodopsin family
   Adrenaline
    ADRA2
     D08205  Methyldopa (INN)
BRITE hierarchy
Other DBs
CAS: 555-30-6
PubChem: 96024893
ChEBI: 61058
ChEMBL: CHEMBL459
DrugBank: DB00968
LigandBox: D08205
NIKKAJI: J9.247I
KCF data Show

ATOM        15
            1   C1d C    27.4400  -15.8200
            2   C6a C    28.6300  -15.1200
            3   C1b C    26.2500  -15.1200
            4   C1a C    26.9500  -17.2200
            5   N1a N    28.4200  -17.2200
            6   O6a O    29.8200  -15.8200
            7   O6a O    28.6300  -13.7900
            8   C8y C    25.0600  -15.8200
            9   C8x C    23.8700  -15.1200
            10  C8x C    25.0600  -17.2200
            11  C8y C    22.6800  -15.8200
            12  C8x C    23.8700  -17.8500
            13  C8y C    22.6800  -17.2200
            14  O1a O    21.4900  -15.1200
            15  O1a O    21.4900  -17.8500
BOND        15
            1     1   2 1
            2     1   3 1
            3     1   4 1 #Down
            4     1   5 1 #Up
            5     2   6 1
            6     2   7 2
            7     3   8 1
            8     8   9 1
            9     8  10 2
            10    9  11 2
            11   10  12 1
            12   11  13 1
            13   11  14 1
            14   13  15 1
            15   12  13 2

» Japanese version   » Back

DBGET integrated database retrieval system