KEGG   Homo sapiens (human): 165140Help
Entry
165140            CDS       T01001                                 

Gene name
OXER1, GPCR, GPR170, TG1019
Definition
(RefSeq) oxoeicosanoid (OXE) receptor 1
  KO
K10043  
oxoeicosanoid receptor 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    165140 (OXER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p21
AA seq 423 aa AA seqDB search
MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS
FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH
TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV
VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY
RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV
VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP
NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS
SQG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcaccgtggtggccagctgatagtgccaatcatcccactttgccctgagcac
tcctgcaggggtagaagactccagaaccttctctcaggcccatggcccaagcagcccatg
gaacttcataacctgagctctccatctccctctctctcctcctctgttctccctccctcc
ttctctccctcaccctcctctgctccctctgcctttaccactgtgggggggtcctctgga
gggccctgccaccccacctcttcctcgctggtgtctgccttcctggcaccaatcctggcc
ctggagtttgtcctgggcctggtggggaacagtttggccctcttcatcttctgcatccac
acgcggccctggacctccaacacggtgttcctggtcagcctggtggccgctgacttcctc
ctgatcagcaacctgcccctccgcgtggactactacctcctccatgagacctggcgcttt
ggggctgctgcctgcaaagtcaacctcttcatgctgtccaccaaccgcacggccagcgtt
gtcttcctcacagccatcgcactcaaccgctacctgaaggtggtgcagccccaccacgtg
ctgagccgtgcttccgtgggggcagctgcccgggtggccgggggactctgggtgggcatc
ctgctcctcaacgggcacctgctcctgagcaccttctccggcccctcctgcctcagctac
agggtgggcacgaagccctcggcctcgctccgctggcaccaggcactgtacctgctggag
ttcttcctgccactggcgctcatcctctttgctattgtgagcattgggctcaccatccgg
aaccgtggtctgggcgggcaggcaggcccgcagagggccatgcgtgtgctggccatggtg
gtggccgtctacaccatctgcttcttgcccagcatcatctttggcatggcttccatggtg
gctttctggctgtccgcctgccgatccctggacctctgcacacagctcttccatggctcc
ctggccttcacctacctcaacagtgtcctggaccccgtgctctactgcttctctagcccc
aacttcctccaccagagccgggccttgctgggcctcacgcggggccggcagggcccagtg
agcgacgagagctcctaccaaccctccaggcagtggcgctaccgggaggcctctaggaag
gcggaggccatagggaagctgaaagtgcagggcgaggtctctctggaaaaggaaggctcc
tcccagggctga

DBGET integrated database retrieval system