KEGG   Homo sapiens (human): 1659Help
Entry
1659              CDS       T01001                                 

Gene name
DHX8, DDX8, HRH1, PRP22, PRPF22
Definition
DEAH (Asp-Glu-Ala-His) box polypeptide 8 (EC:3.6.4.13)
Orthology
K12818  
ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.31
AA seq 1220 aa AA seqDB search
MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQEKQRDAEHRDRTKKKKRSRSR
DRNRDRDRDRERNRDRDHKRRHRSRSRSRSRTRERNKVKSRYRSRSRSQSPPKDRKDRDK
YGERNLDRWRDKHVDRPPPEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISEL
RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNE
ETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFD
EETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQS
ALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKK
HAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQ
YLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKY
MTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATL
DAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFL
TGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATN
IAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCY
RLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQ
LYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYR
PKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRK
QMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA
LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEP
LYNRYEEPNAWRISRAFRRR
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggctgtagccatggcgggagccttaatcgggtcggagccaggccccgcggaa
gaacttgccaaactcgagtacctgtctttggtgtcaaaggtttgcactgagctggacaat
cacttggggatcaacgacaaggaccttgctgaatttgtgatcagtcttgctgagaaaaat
accacctttgatacttttaaggcttctctcgtcaaaaatggtgcagaatttacggattct
cttattagtaacttgctgcgtctcatacaaaccatgcggcctccagcgaagccttccact
agcaaagatccagttgttaaacctaaaacagaaaaagaaaagctgaaggaactcttccca
gtcctttgccaaccggacaacccttctgttcggaccatgttggatgaagatgatgtgaaa
gttgctgtggatgtcctgaaagaactggaagctttaatgcccagcgcagcaggccaggag
aagcaaagagatgctgaacaccgggacaggacaaagaagaagaagcggagtcgaagccga
gatcgaaaccgagatcgagacagagatagggaacgaaaccgagatagagaccacaagcgg
agacaccgatcccgctctcgatcacgttccaggacccgggagaggaataaagtgaagtct
agatatcggtccaggagcaggagtcagagtccccccaaagaccggaaggaccgggacaaa
tatggagagcggaatctggatagatggcgggataagcatgtggaccgccctcctccagaa
gagcccaccattggtgacatttataatggcaaagttaccagcatcatgcagtttggttgc
tttgtgcagctggaaggactaaggaagcggtgggaaggcctggtgcacatctctgagctc
cggcgggagggtcgtgtggccaatgtagctgatgtcgtgagcaaaggccagagggtcaaa
gtcaaagtgctgtccttcactgggaccaagaccagcctgagcatgaaggatgtggatcaa
gagactggagaagatctaaacccaaatagacggcgaaatcttgtcggggagaccaatgag
gagacctcaatgcggaatcctgatagacccactcacttgtcccttgtcagtgctcctgaa
gtagaggacgactcactggaacgcaagcgcctcacccgaatctctgacccagagaagtgg
gagatcaaacagatgattgctgccaatgtcctttccaaagaagaatttccagactttgat
gaagagactggcattctccctaaggtggatgatgaagaagatgaggaccttgagattgaa
ttggttgaggaagagcctccattcctgagagggcacactaagcaaagcatggacatgagc
cccattaaaattgtcaagaacccagacggctccctctcccaagcagcaatgatgcagagt
gccttggccaaagaaaggcgggaactcaaacaggcccagcgggaagctgagatggattct
attcccatgggactcaacaaacactgggttgaccctctgcctgatgcggaaggcagacag
attgctgccaacatgaggggtattgggatgatgcccaatgatattcctgagtggaagaag
catgcctttgggggcaacaaagcctcttacggaaaaaagacccagatgtcaatccttgag
cagagggagagcctgcccatctacaaactgaaggagcaattggtccaggccgtccatgac
aatcagatcctgattgtcattggtgagacaggatctggaaagacaacacagatcacccag
tacctggcggaggcaggctacacttccaggggcaagattgggtgtacccagcccagaaga
gtggcagctatgtcggtggccaaaagagtgtcagaggagtttggttgttgcttaggccaa
gaggtgggctacaccattcgatttgaggactgcactagccctgaaacagtcatcaagtac
atgacagatgggatgttgcttagagagtgcttgattgaccctgacctcactcagtacgcg
atcatcatgttggacgaggcacatgagaggacaattcacactgatgtgctctttggattg
ttgaaaaagacagttcagaaacggcaggacatgaagctgattgtcacctcagccaccttg
gatgcagtgaagttttctcaatacttctatgaagctcccattttcaccatcccaggtcga
acatatccagtggaaatactgtacacaaaggaacctgagacagattatctggatgccagc
ctgattactgttatgcagattcatttaacagaaccaccaggtgatatcctggtcttcctg
actggtcaggaagaaattgatactgcttgtgagatcctgtatgaaagaatgaaatccctg
ggacctgatgttccagagttaattatcctcccagtgtactctgctcttcccagtgagatg
cagacccgaatctttgacccagctccaccaggcagcagaaaggttgtgattgccaccaat
atcgcagagacatcgctgactattgatggtatctactatgtggtggacccaggattcgtg
aaacagaaagtttacaattccaagacagggattgaccagctcgtggtgacgcctatttct
caggctcaggcaaagcaacgagctggcagagctgggagaacaggcccagggaagtgttac
aggttgtacacagaacgtgcctaccgagatgaaatgctgaccaccaacgtgccggaaatc
cagagaaccaacttagcaagcacagtgctgtcactcaaggccatgggtatcaatgatctg
ctgtcctttgatttcatggatgccccacctatggaaactttgatcacagccatggagcag
ctgtacacactgggggccctggatgacgagggcctgctcactcgcttgggccgccggatg
gcagagttccctctggagccaatgctatgcaaaatgctcatcatgtctgtgcatctgggc
tgcagtgaggaaatgctgaccattgtatccatgctgtctgtgcagaacgtcttctatagg
cccaaggataaacaagcccttgcagatcagaagaaggccaaattccaccagactgaaggg
gaccacctcaccctgctagctgtgtacaactcctggaagaacaacaagttctccaaccca
tggtgctatgagaactttatccaggctcgttccctgcgccgggcccaggacattcgcaag
cagatgttaggcataatggacagacacaagctggatgttgtttcctgtggcaagtccaca
gtccgagtgcagaaggccatctgcagtgggttcttccgtaatgctgccaagaaagacccg
caggagggttaccggacactgatcgaccagcaggtggtctatatccatccttccagtgcc
ctcttcaacagacagccagaatgggtggtgtaccatgagctggtgctcaccaccaaggaa
tacatgcgtgaagttaccaccatcgaccctcggtggcttgtggagtttgccccagccttc
ttcaaggtctcagacccaactaagctaagcaaacagaagaagcaacagcgtcttgaaccc
ttgtacaaccgctatgaggaacccaatgcctggagaatatctcgagctttccgacggcgc
tga

DBGET integrated database retrieval system