KEGG   Homo sapiens (human): 166012Help
Entry
166012            CDS       T01001                                 

Gene name
CHST13, C4ST3
Definition
(RefSeq) carbohydrate sulfotransferase 13
  KO
K07779  chondroitin 4-sulfotransferase 13 [EC:2.8.2.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    166012 (CHST13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     166012 (CHST13)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   166012 (CHST13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 166012
NCBI-ProteinID: NP_690849
OMIM: 610124
HGNC: 21755
Ensembl: ENSG00000180767
Vega: OTTHUMG00000162721
Pharos: Q8NET6(Tbio)
UniProt: Q8NET6
Position
3q21.3
AA seq 341 aa AA seqDB search
MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQ
DPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNW
KRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERL
ASAYRNKLARPYSAAFQRRYGARIVQRLRPRALPDARARGHDVRFAEFLAYLLDPRTRRE
EPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAAS
RDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggggaggcgctgctgccggcggcgcgtgctggcggccgcctgtctgggcgccgcgctc
ctgctcctatgcgccgcgccccgctccctgcgcccggcatttggaaacagagccctgggc
tccagctggcttggtggggagaagagaagccccctgcagaagctctatgacctggatcag
gacccgcgctcgaccctggcgaaggtgcaccggcagcggcgcgacctgctgaacagcgcc
tgtagccgccactcacgccggcagcgcctgctacagccggaggacctgcggcacgtgctg
gtggacgacgcgcatggcctgctctactgctacgtgcccaaggtggcctgcaccaactgg
aagcgcgtgctgctggcgctgagcggccaagcccgcggcgacccgcgcgccatctccgcg
caagaggcgcacgcgcctggccgcctgccctcactggccgacttcagccccgccgagatc
aaccggcgcctgcgcgcctacttggccttcctgttcgtgcgggagcccttcgagcgcctg
gcatcggcttaccgcaacaagctcgcgcgcccctacagcgccgccttccagaggcgctac
ggtgcacgcatcgttcagcgcctgcggccgcgcgcgctccccgacgcccgggcccgcggc
cacgacgtgcgcttcgcggagttcctggcctacctgctggacccgcgcacgcggcgtgag
gagcccttcaacgagcactgggagcgcgcgcacgcgctctgccacccgtgtcgcctccgc
tacgacgtcgtgggcaagttcgagacgctggcggaggacgcggccttcgtgctgggcctg
gcgggcgcatccgacctgagcttccctgggccgccgcggccccggggagccgccgcctcc
cgcgacctggcagcgcgcctcttccgggacatcagccccttctaccagcggcgcctcttc
gacctctacaagatggacttcctgcttttcaactactccgccccctcctacctgcggctg
ctctag

DBGET integrated database retrieval system