KEGG   Homo sapiens (human): 1662Help
Entry
1662              CDS       T01001                                 

Gene name
DDX10, Dbp4, HRH-J8
Definition
(RefSeq) DEAD-box helicase 10
  KO
K14776  
ATP-dependent RNA helicase DDX10/DBP4 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1662 (DDX10)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Helicases
    1662 (DDX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13206(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q22.3
AA seq 875 aa AA seqDB search
MGKTANSPGSGARPDPVRSFNRWKKKHSHRQNKKKQLRKQLKKPEWQVERESISRLMQNY
EKINVNEITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKT
LAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGGKD
LKHEAERINNINILVCTPGRLLQHMDETVSFHATDLQMLVLDEADRILDMGFADTMNAVI
ENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHEKAKYSTPATLEQNYIVCELQQK
ISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGVSILALHGRQQQMRRMEVYNE
FVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPEDANTYIHRAGRTARYKEDGEALLILL
PSEKAMVQQLLQKKVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVY
LMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSL
TNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQDNDTGNEEQEEEEDDEEEMEEKLAKAK
GSQAPSLPNTSEAQKIKEVPTQFLDRDEEEEDADFLKVKRHNVFGLDLKDEKTLQKKEPS
KSSIKKKMTKVAEAKKVMKRNFKVNKKITFTDEGELVQQWPQMQKSAIKDAEEDDDTGGI
NLHKAKERLQEEDKFDKEEYRKKIKAKHREKRLKEREARREANKRQAKAKDEEEAFLDWS
DDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKKQGMKKRSNSEVEDVGPTS
HNRKKARWDTLEPLDTGLSLAEDEELVLHLLRSQS
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaacggccaactctccgggttcgggagcccgacccgacccggtgcggagcttc
aatcgctggaagaaaaaacacagccataggcagaacaaaaagaagcagttgaggaagcaa
ctgaagaaacccgaatggcaggtcgagcgcgagagtatcagccgcctcatgcagaactat
gaaaagataaatgtaaatgaaatcacaagattttcagattttcccttgtccaaaaaaaca
ttgaaaggtttgcaagaagctcagtaccgtttggtgactgagatacagaagcagaccatt
ggattggctttgcaaggtaaagatgtacttggagcggccaaaactggatctggcaagact
ctggcttttcttgttccagtgctggaagccttatatcgtctgcaatggacttcaacagat
gggctgggggttctcataatatcacctacgagagaactggcctatcagacctttgaggtt
ctccgaaaagtaggaaagaatcatgacttctcagctggtctcatcattggtggaaaggat
ctaaaacacgaagctgagaggatcaacaacataaatatactcgtgtgcacaccaggtcgg
cttcttcaacacatggatgaaacagtatcttttcatgctaccgacctccaaatgttagtt
cttgatgaagcagatagaatcttggatatgggctttgctgataccatgaatgctgttatt
gaaaatctccccaagaaacgtcagactttacttttctcagcaacacaaactaaatctgta
aaggaccttgcacgcttgagtttgaaaaaccctgagtatgtctgggttcatgaaaaagca
aaatatagcacccctgccactttggaacagaactacatagtctgtgagctgcagcaaaaa
ataagtgtgctgtattcctttttgagaagccatctgaagaagaagagcattgtatttttt
tccagttgcaaagaggtccagtatctgtaccgagtgttttgccggctacgtcctggtgtt
tctatccttgcactccatggtcgacagcagcaaatgagaagaatggaagtctataatgag
tttgtccgtaagagagctgcagtactctttgctactgatattgcagccaggggtctggat
ttcccggccgtgaattgggttcttcagtttgattgtcctgaggatgccaacacatatatt
cacagagcaggtagaactgccaggtacaaagaggatggtgaagctttgctaattttgcta
ccctcagaaaaagctatggtgcagcagcttcttcagaagaaagtacctgtgaaggaaatc
aaaatcaatccagaaaaacttatagatgtccagaaaaaattggaatctattttagctcaa
gatcaagatttaaaagaaagagctcaaaggtgtttcgtctcctatgtacgatctgtatat
ctgatgaaggataaagaagtatttgatgtgagcaagttacctatacctgaatatgccctg
tctcttggtcttgctgtggcaccacgcgtaagatttcttcagaaaatgcagaaacaaccc
accaaagaattggtaaggagccaagccgataaagtaattgagccaagggctccctccctc
accaatgacgaagtggaagaatttagagcctacttcaatgagaaaatgtccatccttcaa
aaaggtggaaaaagactcgaagggacagagcacagacaggataatgatactggtaatgaa
gaacaggaagaagaagaagacgatgaagaagaaatggaagagaaactggcaaaagcaaaa
ggatctcaagccccatctcttcctaacaccagtgaggcacagaagatcaaggaagttcct
acacagttcttggacagagatgaggaggaagaagatgctgatttcttgaaggtgaagcgg
cataatgtgtttggattggaccttaaagacgagaaaacattacagaagaaagaaccttct
aaatccagcatcaagaaaaaaatgaccaaagttgcagaagcaaaaaaagtaatgaagaga
aattttaaagtgaataagaagataacatttactgatgaaggggagttggttcagcagtgg
ccacaaatgcagaaatctgccatcaaggatgctgaggaagatgatgacacaggtggtatc
aacttacataaagcaaaggaaagacttcaggaagaggacaaatttgacaaagaagaatat
aggaaaaaaattaaggcaaagcatcgggagaaaagactgaaagaaagggaagccagaaga
gaagccaacaagagacaagcaaaggccaaagatgaagaggaagcctttctggattggagt
gatgatgatgatgatgatgatgatggatttgatccaagcacactcccagatccagataaa
tacagaagctctgaagattcagatagtgaagatatggaaaataaaataagtgataccaag
aagaagcaggggatgaagaagaggagcaacagtgaagtggaagacgtgggaccaacaagt
cataacagaaagaaggccaggtgggacactttagagcctttggataccggcctgtcttta
gcagaggatgaagagctggtgttacatctgctaagaagtcaaagctaa

DBGET integrated database retrieval system