KEGG   Homo sapiens (human): 166378Help
Entry
166378            CDS       T01001                                 

Gene name
SPATA5, AFG2, EHLMRS, SPAF
Definition
(RefSeq) spermatogenesis associated 5
  KO
K14575  AAA family ATPase
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Disease
H00577  Symptomatic generalized epilepsies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    166378 (SPATA5)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    166378 (SPATA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA RuvB_N AAA_5 TIP49 AAA_16 AAA_2 AAA_33 AAA_22 Mg_chelatase AAA_25 AAA_28 IstB_IS21 RNA_helicase AAA_18 Parvo_NS1 AAA_3 TsaE Sigma54_activ_2 ATPase AAA_14 Zeta_toxin Sigma54_activat AAA_24 DUF815 Rad17 AAA_11 NACHT CDC48_N PorP_SprF
Motif
Other DBs
NCBI-GeneID: 166378
NCBI-ProteinID: NP_660208
OMIM: 613940
HGNC: 18119
Ensembl: ENSG00000145375
Vega: OTTHUMG00000133074
Pharos: Q8NB90(Tdark)
UniProt: Q8NB90
Position
4q28.1
AA seq 893 aa AA seqDB search
MSSKKNRKRLNQSAENGSSLPSAASSCAEARAPSAGSDFAATSGTLTVTNLLEKVDDKIP
KTFQNSLIHLGLNTMKSANICIGRPVLLTSLNGKQEVYTAWPMAGFPGGKVGLSEMAQKN
VGVRPGDAIQVQPLVGAVLQAEEMDVALSDKDMEINEEELTGCILRKLDGKIVLPGNFLY
CTFYGRPYKLQVLRVKGADGMILGGPQSDSDTDAQRMAFEQSSMETSSLELSLQLSQLDL
EDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGN
EQLTEEERLLKFSIGAKCNTDTFYFISSTTRVNFTEIDKNSKEQDNQFKVTYDMIGGLSS
QLKAIREIIELPLKQPELFKSYGIPAPRGVLLYGPPGTGKTMIARAVANEVGAYVSVING
PEIISKFYGETEAKLRQIFAEATLRHPSIIFIDELDALCPKREGAQNEVEKRVVASLLTL
MDGIGSEVSEGQVLVLGATNRPHALDAALRRPGRFDKEIEIGVPNAQDRLDILQKLLRRV
PHLLTEAELLQLANSAHGYVGADLKVLCNEAGLCALRRILKKQPNLPDVKVAGLVKITLK
DFLQAMNDIRPSAMREIAIDVPNVSWSDIGGLESIKLKLEQAVEWPLKHPESFIRMGIQP
PKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVRETFRKARAVA
PSIIFFDELDALAVERGSSLGAGNVADRVLAQLLTEMDGIEQLKDVTILAATNRPDRIDK
ALMRPGRIDRIIYVPLPDAATRREIFKLQFHSMPVSNEVDLDELILQTDAYSGAEIVAVC
REAALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaagaagaatagaaagcggttgaaccaaagcgcggaaaatggttcgtccttg
ccctctgctgcttcctcttgtgcggaggcacgggctccttctgctggatcagacttcgcg
gcaacctccgggactctgacggtgaccaacttattagaaaaggtagatgacaaaattcct
aaaacattccagaattcccttattcatcttggactcaacactatgaagtctgcaaatata
tgtataggtcgaccagtgttgcttactagtttgaacggaaagcaagaggtgtatacagcc
tggcctatggcaggatttcctggaggcaaggtcggcctgagtgaaatggcacagaaaaat
gtgggtgtgaggcctggtgatgccatccaggtccagcctcttgtgggtgctgtgctacag
gctgaggaaatggatgtggcactgagtgacaaagatatggaaattaatgaagaagaactg
actggttgtatcctgagaaaactagatggcaagattgttttaccaggcaactttctgtat
tgtacattctatggacgaccgtacaagctgcaagtattgcgagtgaaaggggcagatggc
atgatattgggagggcctcagagtgactctgacactgatgcccaaagaatggcctttgaa
cagtccagcatggaaaccagtagcctggagttatccttacagctaagccagttagatctg
gaggatacccagatcccaacatcaagaagtactccttataaaccaattgatgacagaatt
acaaataaagccagtgatgttttgctggatgttacacagagccctggagatggcagtgga
cttatgctagaggaagtcacaggtcttaaatgtaattttgaatctgccagagaaggaaat
gagcaacttactgaagaagagagactgctaaagttcagcataggagcaaagtgcaatact
gatactttttattttatttcttcaacaacaagagtcaattttacagagattgataaaaat
tcaaaagagcaagacaaccaattcaaagtaacttatgacatgataggaggattaagtagc
cagctgaaagcaattagagaaataattgaattgcccctcaaacagcctgagcttttcaag
agttatggaattcctgcccctagaggagtgttactttatggtcctccaggtactggaaaa
acaatgatcgccagggctgttgctaatgaagttggagcctatgtttctgtaattaatggt
cctgaaattataagcaaattctatggtgagactgaagcaaagttacgtcagatatttgct
gaagccactctacgacacccatcaattatttttattgatgagctggatgcactttgtccg
aaaagagagggggcccagaatgaagtggaaaaaagagttgtggcttcactcttaacactg
atggatggcattggttcagaagtaagtgaaggacaagtgttggttcttggggccacaaat
cgccctcatgccttggatgctgctctccgaagacctgggcgatttgataaagagattgag
attggagttcccaatgctcaggaccggctagatattctccagaaactgcttcgaagggta
ccccatttgctcactgaggctgagctgctgcagctggcaaatagtgctcatggatacgtt
ggagcagacttgaaagtcttgtgtaatgaagcaggtctctgtgccttgcggagaatcctg
aaaaaacagcctaacctccctgatgtcaaggtggctggactggtgaagattactctgaag
gatttcttgcaggcaatgaatgatatcagacccagtgccatgagggaaatagcaattgat
gtcccaaatgtatcctggtcagatataggaggactggaaagtatcaaactgaagttggaa
caggctgtggaatggcccttaaaacatccagagtctttcattcgaatgggtattcagcca
cctaaaggagttcttctctatgggccacctgggtgctctaaaacaatgatagcaaaggct
ttggccaatgagagtggactgaattttctagctataaaggggcctgaattaatgaataaa
tatgttggtgaatctgaaagagcagttagagagaccttccgaaaagcaagagcagtggcg
ccttccattattttctttgatgaactggatgccttagcagttgaaaggggcagttcttta
ggtgctgggaatgtagccgatcgtgttttggctcagctcttaacagaaatggatgggatt
gaacagctaaaggatgtgaccattttggcagctactaaccgtccagataggatagacaag
gctttgatgcggcctggaagaattgatagaatcatctatgtgcctttaccggatgcagca
acaagaagggaaatatttaagctgcagtttcactccatgcctgtcagtaatgaagttgac
ctggatgaactcatccttcaaaccgacgcatactcaggagcagagattgtagctgtctgc
agagaggcagctcttctggctctggaagaagacattcaagccaatctcatcatgaaaaga
catttcactcaggccttgagcactgtgacacctagaattcctgagtcattgagacgtttt
tatgaagattatcaagagaagagtgggctgcatacactctga

DBGET integrated database retrieval system