KEGG   Homo sapiens (human): 166647Help
Entry
166647            CDS       T01001                                 

Gene name
ADGRA3, GPR125, PGR21, TEM5L
Definition
(RefSeq) adhesion G protein-coupled receptor A3
  KO
K08462  G protein-coupled receptor 125
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    166647 (ADGRA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 7tm_2 LRR_4 LRR_5 GPS I-set HRM LRR_9 ig
Motif
Other DBs
NCBI-GeneID: 166647
NCBI-ProteinID: NP_660333
OMIM: 612303
HGNC: 13839
Ensembl: ENSG00000152990
Vega: OTTHUMG00000160926
Pharos: Q8IWK6(Tbio)
UniProt: Q8IWK6
Position
4p15.2
AA seq 1321 aa AA seqDB search
MEPPGRRRGRAQPPLLLPLSLLALLALLGGGGGGGAAALPAGCKHDGRPRGAGRAAGAAE
GKVVCSSLELAQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSI
DPGAFWGLSSLKRLDLTNNRIGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLR
SLEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLE
LPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIH
NCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGD
FRWPRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDV
TRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSK
ELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNI
ALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL
ALKNTIVEASIQLPPSLFSPKQKRELRPTDDSLYKLQLIAFRNGKLFPATGNSTNLADDG
KRRTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAVAARWDFDLLNGQGGWKSDGC
HILYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPVVYTTAIILLLCLLAVIVS
YIYHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATV
LWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNY
GSRPNAPYCWMAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQ
RLAANENGEINHQDSMSLSLISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLY
YPLDLVFSFVFGATSLSFSAFFVVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPNSN
GTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQAAAAQCHANSLPLNSTPQLDN
SLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREYAYDVPTSVEG
SVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTT
SKKDALRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETT
V
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atggagccacccggacgccggcggggccgcgcgcagccgccgctgttgctgccgctctcg
ctgttagcgctgctcgcgctgctgggaggcggcggcggcggcggcgccgcggcgctgccc
gccggctgcaagcacgatgggcggccccgaggggctggcagggcggcgggcgccgccgag
ggcaaggtggtgtgcagcagcctggaactcgcgcaggtcctgcccccagatactctgccc
aaccgcacggtcaccctgattctgagtaacaataagatatccgagctgaagaatggctca
ttttctgggttaagtctccttgaaagattggacctccgaaacaatcttattagtagtata
gatccaggtgccttctggggactgtcatctctaaaaagattggatctgacaaacaatcga
ataggatgtctgaatgcagacatatttcgaggactcaccaatctggttcggctaaacctt
tcggggaatttgttttcttcattatctcaaggaacttttgattatcttgcgtcattacgg
tctttggaattccagactgagtatcttttgtgtgactgtaacatactgtggatgcatcgc
tgggtaaaggagaagaacatcacggtacgggataccaggtgtgtttatcctaagtcactg
caggcccaaccagtcacaggcgtgaagcaggagctgttgacatgcgaccctccgcttgaa
ttgccgtctttctacatgactccatctcatcgccaagttgtgtttgaaggagacagcctt
cctttccagtgcatggcttcatatattgatcaggacatgcaagtgttgtggtatcaggat
gggagaatagttgaaaccgatgaatcgcaaggtatttttgttgaaaagaacatgattcac
aactgctccttgattgcaagtgccctaaccatttctaatattcaggctggatctactgga
aattggggctgtcatgtccagaccaaacgtgggaataatacgaggactgtggatattgtg
gtattagagagttctgcacagtactgtcctccagagagggtggtaaacaacaaaggtgac
ttcagatggcccagaacattggcaggcattactgcatatctgcagtgtacgcggaacacc
catggcagtgggatatatcccggaaacccacaggatgagagaaaagcttggcgcagatgt
gatagaggtggcttttgggcagatgatgattattctcgctgtcagtatgcaaatgatgtc
actagagttctttatatgtttaatcagatgcccctcaatcttaccaatgccgtggcaaca
gctcgacagttactggcttacactgtggaagcagccaacttttctgacaaaatggatgtt
atatttgtggcagaaatgattgaaaaatttggaagatttaccaaggaggaaaaatcaaaa
gagctaggtgacgtgatggttgacattgcaagtaacatcatgttggctgatgaacgtgtc
ctgtggctggcgcagagggaagctaaagcctgcagtaggattgtgcagtgtcttcagcgc
attgctacctaccggctagccggtggagctcacgtttattcaacatattcacccaatatt
gctctggaagcttatgtcatcaagtctactggcttcacggggatgacctgtaccgtgttc
cagaaagtggcagcctctgatcgtacaggactttcggattatgggaggcgggatccagag
ggaaacctggataagcagctgagctttaagtgcaatgtttcaaatacattttcgagtctg
gcactaaagaatactattgtggaggcttctattcagcttcctccttcccttttctcacca
aagcaaaaaagagaactcagaccaactgatgactctctttacaagcttcaactcattgca
ttccgcaatggaaagctttttccagccactggaaattcaacaaatttggctgatgatgga
aaacgacgtactgtggttacccctgtgattctcaccaaaatagatggtgtgaatgtagat
acccaccacatccctgttaatgtgacactgcgtcgaattgcacatggagcagatgctgtt
gcagcccggtgggatttcgatttgctgaacggacaaggaggctggaagtcagatgggtgc
catatactctattcagatgaaaatatcactacgattcagtgctactcccttagtaactat
gcagttttaatggatttgacgggatctgaactatacacccaggcggccagcctcctgcat
cctgtggtttatactaccgctatcattctcctcttatgtctcttagccgtcattgtcagt
tacatataccatcacagtttgattagaatcagcctcaagagctggcacatgcttgtgaac
ttgtgctttcatattttcctaacctgtgtggtctttgtgggaggaataacccagactagg
aatgccagcatctgccaagcagttgggataattcttcactattccacccttgccacagta
ctatgggtaggagtgacagctcgaaatatctacaaacaagtcactaaaaaagctaaaaga
tgccaggatcctgatgaaccaccacctccaccaagaccaatgctcagattttacctgatt
ggtggtggtatccccatcattgtttgcggcataactgcagcagcgaacattaagaattac
ggcagtcggccaaacgcaccctattgctggatggcatgggaaccctccttgggagccttc
tatgggccagccagcttcatcacttttgtaaactgcatgtactttctgagcatatttatt
cagttgaaaagacaccctgagcgcaaatatgagcttaaggagcccacggaggagcaacag
agattggcagccaatgaaaatggcgaaataaatcatcaggattcaatgtctttgtctctg
atttctacatcagccttggaaaatgagcacacttttcattctcagctcttgggggccagc
cttactttgctcttatatgttgcactgtggatgtttggggctttggctgtttctttgtat
taccctttggacttggtttttagcttcgtttttggagccacaagtttaagcttcagtgcg
ttcttcgtggtccaccattgtgttaatagggaggatgttagacttgcgtggatcatgact
tgctgcccaggacggagctcgtattcagtgcaagtcaacgtccagccccccaactctaat
gggacgaatggagaggcacccaaatgccccaatagcagtgcggagtcttcatgcacaaac
aaaagtgcttcaagcttcaaaaattcctcccagggctgcaaattaacaaacttgcaggcg
gctgcagctcagtgccatgccaattctttacctttgaactccacccctcagcttgataat
agtctgacagaacattcaatggacaatgatattaaaatgcacgtggcgcctttagaagtt
cagtttcgaacaaatgtgcactcaagccgccaccataaaaacagaagtaaaggacaccgg
gcaagccgactcacagtcctgagagaatatgcctacgatgtcccaacgagcgtggaagga
agcgtgcagaacggcttacctaaaagccggctgggcaataacgaaggacactcgaggagc
cgaagagcttatttagcctacagagagagacagtacaacccaccccagcaagacagcagc
gatgcttgtagcacacttcccaaaagtagcagaaattttgaaaagccagtttcaaccact
agtaaaaaagatgcgttaaggaagccagctgtggttgaacttgaaaatcagcaaaaatct
tatggcctcaacttggccattcagaatggaccaattaaaagcaatgggcaggagggaccc
ttgctcggtaccgatagcactggcaatgttaggactggattatggaaacacgaaactact
gtgtaa

DBGET integrated database retrieval system