KEGG   Homo sapiens (human): 166785Help
Entry
166785            CDS       T01001                                 

Gene name
MMAA, cblA
Definition
methylmalonic aciduria (cobalamin deficiency) cblA type
Orthology
K07588  
LAO/AO transport system kinase [EC:2.7.-.-]
Organism
hsa  Homo sapiens (human)
Disease
H00174  
Methylmalonic aciduria (MMA)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31.21
AA seq 418 aa AA seqDB search
MPMLLPHPHQHFLKGLLRAPFRCYHFIFHSSTHLGSGIPCAQPFNSLGLHCTKWMLLSDG
LKRKLCVQTTLKDHTEGLSDKEQRFVDKLYTGLIQGQRACLAEAITLVESTHSRKKELAQ
VLLQKVLLYHREQEQSNKGKPLAFRVGLSGPPGAGKSTFIEYFGKMLTERGHKLSVLAVD
PSSCTSGGSLLGDKTRMTELSRDMNAYIRPSPTRGTLGGVTRTTNEAILLCEGAGYDIIL
IETVGVGQSEFAVADMVDMFVLLLPPAGGDELQGIKRGIIEMADLVAVTKSDGDLIVPAR
RIQAEYVSALKLLRKRSQVWKPKVIRISARSGEGISEMWDKMKDFQDLMLASGELTAKRR
KQQKVWMWNLIQESVLEHFRTHPTVREQIPLLEQKVLIGALSPGLAADFLLKAFKSRD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgctgctaccacatcctcaccagcatttcctaaaaggccttttaagagcacct
ttccgatgttaccacttcatctttcactcaagtactcatctcggatcaggaatcccatgt
gctcagccgtttaattctcttggactccattgtacaaagtggatgctgctgtcagatggc
ttaaagagaaaattatgtgtacaaacaaccttaaaggaccacacagaaggactttctgat
aaagagcaaagatttgtggataaactttatactggtttaatccaagggcaaagggcctgt
ttagcagaggccataactcttgtagaatcaactcacagcaggaaaaaggagttagcccag
gtgcttcttcagaaagtattactttaccacagagaacaagaacaatcaaataaaggaaaa
ccactagcatttcgagtaggattgtctgggccccctggtgctggaaaatcaacatttata
gaatattttggaaaaatgcttactgagagagggcacaaattatctgtgctagctgtggac
ccttcttcttgtactagtggtggatcactcttaggtgataaaacccgaatgactgagtta
tcaagagatatgaatgcatacatcaggccatctcctactagaggaactttaggaggcgtg
acaaggaccacaaatgaagctattctgttgtgtgaaggagcgggatatgacataattctt
attgaaaccgttggtgtgggtcagtcggagtttgctgttgctgacatggttgacatgttt
gttttactactgccaccagcaggaggagatgagctgcagggtatcaaaaggggtataatc
gagatggcagatctggtagctgtaactaaatctgatggagacttgattgtgccagctcga
aggatacaagcggaatatgtgagtgcactgaaattactccgcaaacgttcacaagtctgg
aaaccaaaggtaattcgtatttctgcccgaagtggagaggggatctctgaaatgtgggat
aaaatgaaagatttccaggacctaatgcttgccagtggggagctgactgccaaacgacgg
aagcaacagaaagtttggatgtggaatctcattcaggaaagtgtgttagagcatttcagg
acccaccccacagtccgggaacagattccacttctggaacaaaaggttctcattggggcc
ctgtccccaggactagcagcagacttcttgttaaaagcttttaaaagcagagactaa

DBGET integrated database retrieval system