KEGG   Homo sapiens (human): 167227Help
Entry
167227            CDS       T01001                                 

Gene name
DCP2, NUDT20
Definition
decapping mRNA 2 (EC:3.6.1.62)
Orthology
K12613  
mRNA-decapping enzyme subunit 2 [EC:3.6.1.62]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Module
Decapping complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    167227 (DCP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.62  5'-(N7-methylguanosine 5'-triphospho)-[mRNA] hydrolase
     167227 (DCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q22.2
AA seq 385 aa AA seqDB search
METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQC
GIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLA
KSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGI
PKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLS
RRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKP
YNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHC
KFPFSSRAFLSFKFDHNAIMKILDL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaaacgggtggagattcccggcagcgtcctggacgatctctgcagccgattt
attttgcatattcccagcgaggaaagagacaatgcaatccgagtgtgttttcagattgaa
cttgcccattggttttacttggatttctacatgcagaacacaccaggattacctcagtgt
gggataagagactttgctaaagctgtcttcagtcattgtccgtttttgctgcctcaaggt
gaagatgtggaaaaagttttggatgaatggaaggaatataaaatgggagtaccaacatat
ggtgcaattattcttgatgagacacttgaaaatgtactactagttcaggggtacctagca
aaatcaggctggggatttccaaaaggaaaagtaaataaagaagaagctcctcatgattgt
gctgctagagaggtctttgaagaaactggttttgatatcaaagactatatttgtaaggat
gattacattgaacttcgaatcaatgaccagcttgctcgtttgtacatcattccaggaatt
ccaaaagacacaaaatttaacccaaaaactagaagagaaattcggaacattgagtggttc
tctattgagaaattgccttgtcatagaaatgatatgacccccaaatccaaacttggtttg
gcacctaacaaattttttatggccattccctttatcagaccattaagggactggctttct
cgaagatttggcgattcctcagacagtgacaatggattttcctcaactggtagcacgccg
gctaaacccactgtggaaaaattgagtcgaaccaaattccgccacagtcagcagttattt
cctgacggttctcctggtgaccagtgggtaaagcacaggcaaccactgcagcaaaagcca
tataataatcattctgaaatgtctgaccttttaaaaggaaagaagtgtgaaaagaaactt
catccacggaaacttcaggataattttgaaacagatgctgtatatgacttgcctagctcc
agtgaagaccagttgctagaacatgctgagggacagcccgtggcatgtaatggacattgc
aagttccccttttcatccagagcctttttgagtttcaagtttgaccataatgctataatg
aaaatcttggacctttga

DBGET integrated database retrieval system