KEGG   Homo sapiens (human): 1673Help
Entry
1673              CDS       T01001                                 

Gene name
DEFB4A, BD-2, DEFB-2, DEFB102, DEFB2, DEFB4, HBD-2, SAP1
Definition
(RefSeq) defensin beta 4A
  KO
K21100  beta-defensin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    1673 (DEFB4A)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   1673 (DEFB4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta
Motif
Other DBs
NCBI-GeneID: 1673
NCBI-ProteinID: NP_004933
OMIM: 602215
HGNC: 2767
Ensembl: ENSG00000171711
Vega: OTTHUMG00000129314
Pharos: O15263(Tbio)
UniProt: O15263
Structure
PDB: 

Jmol
Position
8p23.1
AA seq 64 aa AA seqDB search
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC
CKKP
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttgtatctcctcttctcgttcctcttcatattcctgatgcctcttccaggt
gtttttggtggtataggcgatcctgttacctgccttaagagtggagccatatgtcatcca
gtcttttgccctagaaggtataaacaaattggcacctgtggtctccctggaacaaaatgc
tgcaaaaagccatga

DBGET integrated database retrieval system