KEGG   Homo sapiens (human): 1673Help
Entry
1673              CDS       T01001                                 

Gene name
DEFB4A, BD-2, DEFB-2, DEFB102, DEFB2, DEFB4, HBD-2, SAP1
Definition
(RefSeq) defensin beta 4A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p23.1
AA seq 64 aa AA seqDB search
MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC
CKKP
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttgtatctcctcttctcgttcctcttcatattcctgatgcctcttccaggt
gtttttggtggtataggcgatcctgttacctgccttaagagtggagccatatgtcatcca
gtcttttgccctagaaggtataaacaaattggcacctgtggtctccctggaacaaaatgc
tgcaaaaagccatga

DBGET integrated database retrieval system