KEGG   Homo sapiens (human): 1675Help
Entry
1675              CDS       T01001                                 

Gene name
CFD, ADIPSIN, ADN, DF, PFD
Definition
complement factor D (adipsin) (EC:3.4.21.46)
Orthology
K01334  
component factor D [EC:3.4.21.46]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Staphylococcus aureus infection
Disease
H00104  
Alternative complement pathway component defects
Drug target
Other: 
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 253 aa AA seqDB search
MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctgggagcgcctggcagttctggtcctcctaggagcggccgcctgcgcggcg
ccgccccgtggtcggatcctgggcggcagagaggccgaggcgcacgcgcggccctacatg
gcgtcggtgcagctgaacggcgcgcacctgtgcggcggcgtcctggtggcggagcagtgg
gtgctgagcgcggcgcactgcctggaggacgcggccgacgggaaggtgcaggttctcctg
ggcgcgcactccctgtcgcagccggagccctccaagcgcctgtacgacgtgctccgcgca
gtgccccacccggacagccagcccgacaccatcgaccacgacctcctgctgctacagctg
tcggagaaggccacactgggccctgctgtgcgccccctgccctggcagcgcgtggaccgc
gacgtggcaccgggaactctctgcgacgtggccggctggggcatagtcaaccacgcgggc
cgccgcccggacagcctgcagcacgtgctcttgccagtgctggaccgcgccacctgcaac
cggcgcacgcaccacgacggcgccatcaccgagcgcttgatgtgcgcggagagcaatcgc
cgggacagctgcaagggtgactccgggggcccgctggtgtgcgggggcgtgctcgagggc
gtggtcacctcgggctcgcgcgtttgcggcaaccgcaagaagcccgggatctacacccgc
gtggcgagctatgcggcctggatcgacagcgtcctggcctag

DBGET integrated database retrieval system