KEGG   Homo sapiens (human): 168620Help
Entry
168620            CDS       T01001                                 

Gene name
BHLHA15, BHLHB8, MIST1
Definition
basic helix-loop-helix family, member a15
Orthology
K08040  
class B basic helix-loop-helix protein 8
Organism
hsa  Homo sapiens (human)
Pathway
Maturity onset diabetes of the young
Class
Human Diseases; Endocrine and metabolic diseases; Maturity onset diabetes of the young [PATH:hsa04950]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.3
AA seq 189 aa AA seqDB search
MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRR
PGPSGPGGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA
KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYST
QIHSFREGT
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaagaaccggcccccacggcgccgggccccggtgcaggacacagaggccacc
cccggggaggggacgcccgacgggtccctgccgaacccggggccagagccggccaagggt
ctgcggagccggccggcccgggccgcagcaagggctccgggcgagggcaggcgcaggcgg
ccaggaccctccgggcccggtggccgtcgtgacagcagcatccagcggcggctggagagc
aacgagagggagcggcagcggatgcacaagctaaataacgccttccaggccctgcgtgaa
gtcatcccccacgtgcgcgcggacaagaagctctccaagatcgagacgctcacgctggcc
aagaactacatcaaatcgctgacggccaccatcctgaccatgtccagcagccgcctccca
ggcctggaggggccgggccccaagctctaccagcactaccagcagcagcagcaggtggct
gggggtgcgttgggggccacggaggcccagccccagggccacctgcagaggtactccacg
cagatccacagcttccgagagggcacctag

DBGET integrated database retrieval system