KEGG   Homo sapiens (human): 169044Help
Entry
169044            CDS       T01001                                 

Gene name
COL22A1
Definition
(RefSeq) collagen type XXII alpha 1 chain
  KO
K16630  
collagen, type XXII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    169044 (COL22A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NFW1(Tdark)
UniProt: 
Position
8q24.23-q24.3
AA seq 1626 aa AA seqDB search
MAGLRGNAVAGLLWMLLLWSGGGGCQAQRAGCKSVHYDLVFLLDTSSSVGKEDFEKVRQW
VANLVDTFEVGPDRTRVGVVRYSDRPTTAFELGLFGSQEEVKAAARRLAYHGGNTNTGDA
LRYITARSFSPHAGGRPRDRAYKQVAILLTDGRSQDLVLDAAAAAHRAGIRIFAVGVGEA
LKEELEEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGGT
KEITGFDLMDLFSVKEILGKRENGAQSSYVRMGSFPVVQSTEDVFPQGLPDEYAFVTTFR
FRKTSRKEDWYIWQVIDQYSIPQVSIRLDGENKAVEYNAVGAMKDAVRVVFRGSRVNDLF
DRDWHKMALSIQAQNVSLHIDCALVQTLPIEERENIDIQGKTVIGKRLYDSVPIDFDLQR
IVIYCDSRHAELETCCDIPSGPCQVTVVTEPPPPPPPQRPPTPGSEQIGFLKTINCSCPA
GEKGEMGVAGPMGLPGPKGDIGAIGPVGAPGPKGEKGDVGIGPFGQGEKGEKGSLGLPGP
PGRDGSKGMRGEPGELGEPGLPGEVGMRGPQGPPGLPGPPGRVGAPGLQGERGEKGTRGE
KGERGLDGFPGKPGDTGQQGRPGPSGVAGPQGEKGDVGPAGPPGVPGSVVQQEGLKGEQG
APGPRGHQGAPGPPGARGPIGPEGRDGPPGLQGLRGKKGDMGPPGIPGLLGLQGPPGPPG
VPGPPGPGGSPGLPGEIGFPGKPGPPGPTGPPGKDGPNGPPGPPGTKGEPGERGEDGLPG
KPGLRGEIGEQGLAGRPGEKGEAGLPGAPGFPGVRGEKGDQGEKGELGLPGLKGDRGEKG
EAGPAGPPGLPGTTSLFTPHPRMPGEQGPKGEKGDPGLPGEPGLQGRPGELGPQGPTGPP
GAKGQEGAHGAPGAAGNPGAPGHVGAPGPSGPPGSVGAPGLRGTPGKDGERGEKGAAGEE
GSPGPVGPRGDPGAPGLPGPPGKGKDGEPGLRGSPGLPGPLGTKAACGKVRGSENCALGG
QCVKGDRGAPGIPGSPGSRGDPGIGVAGPPGPSGPPGDKGSPGSRGLPGFPGPQGPAGRD
GAPGNPGERGPPGKPGLSSLLSPGDINLLAKDVCNDCPPGPPGLPGLPGFKGDKGVPGKP
GREGTEGKKGEAGPPGLPGPPGIAGPQGSQGERGADGEVGQKGDQGHPGVPGFMGPPGNP
GPPGADGIAGAAGPPGIQGSPGKEGPPGPQGPSGLPGIPGEEGKEGRDGKPGPPGEPGKA
GEPGLPGPEGARGPPGFKGHTGDSGAPGPRGESGAMGLPGQEGLPGKDGDTGPTGPQGPQ
GPRGPPGKNGSPGSPGEPGPSGTPGQKGSKGENGSPGLPGFLGPRGPPGEPGEKGVPGKE
GVPGKPGEPGFKGERGDPGIKGDKGPPGGKGQPGDPGIPGHKGHTGLMGPQGLPGENGPV
GPPGPPGQPGFPGLRGESPSMETLRRLIQEELGKQLETRLAYLLAQMPPAYMKSSQGRPG
PPGPPGKDGLPGRAGPMGEPGRPGQGGLEGPSGPIGPKGERGAKGDPGAPGVGLRGEMGP
PGIPGQPGEPGYAKDGLPGIPGPQGETGPAGHPGLPGPPGPPGQCDPSQCAYFASLAARP
GNVKGP
NT seq 4881 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctccgagggaacgctgtggctggcctcctctggatgctgctgctgtggagt
gggggcggcggctgccaggctcagcgggcaggttgcaaaagtgtccactacgatctggtc
ttcctcctggacacctcctccagcgtgggcaaggaggactttgagaaggtccggcagtgg
gtggccaacctggtggacaccttcgaggtgggccccgaccgcacccgtgtgggggtcgtg
cgctacagcgaccggcccaccacggccttcgagttgggactctttggctcgcaggaggag
gtcaaggcggctgcccggcgtctcgcctaccacgggggcaacaccaacacgggagacgcg
ctccgctacatcacggcccgcagcttctccccacacgccggcggccgccccagggaccgc
gcctacaagcaggtggccatcctgctcaccgacggccgcagccaggacctggtgctggac
gccgcggcggcagcccaccgcgctggcatccgcatctttgccgtgggcgtgggcgaggca
ctcaaggaggagctggaggagatcgcctcagagcccaagtccgcccacgtcttccacgtg
tccgacttcaatgccatcgacaagatccggggcaagctgcggcgccgtctttgtgaaaat
gtgctctgtcctagcgttcgtgtagaaggagatcgctttaagcacaccaatggaggaacc
aaggaaatcacaggttttgacctgatggatttgttcagtgtgaaggaaatcttggggaag
agagagaatggagctcagagttcctatgtacggatgggatccttccctgtggtgcaaagt
actgaggatgtgttcccccaaggtttacctgatgagtacgcctttgtcacaaccttccgg
ttcaggaaaacctctcggaaggaagactggtatatctggcaggtcatcgaccagtacagc
atcccacaggtctccatccggctggatggtgaaaacaaggcagtcgagtacaacgctgtg
ggtgccatgaaagatgctgtcagggtggtcttccgaggttctcgggtcaatgacctcttt
gaccgggactggcacaagatggccctgagcatccaggcccagaacgtctccctgcacatt
gactgtgcgctggtgcagacactacccatcgaggaacgggagaacattgacatccagggc
aagactgtgattggcaagcgcctctacgacagtgtgcccattgactttgacctacagcgg
attgtgatctattgtgactcgagacacgcagaattggagacttgttgtgatatcccctcg
ggtccgtgccaggtgaccgtggtgacagagcctccacctccacccccaccccagcggcct
cccaccccaggcagtgaacagattgggtttttgaagaccatcaactgctcctgcccagct
ggagagaagggtgaaatgggagttgctggccccatggggctccctggtccaaagggagac
ataggagccattgggccggttggcgctcctggacctaagggagagaaaggtgatgtgggc
ataggaccttttggccaaggggaaaagggtgaaaagggttccctgggcctgcccggcccc
cctgggagagacggcagcaaaggcatgagaggggagccaggagagctgggagagccgggg
ctgccgggtgaggtcggcatgcgggggccccaaggaccacctggactccccggacctcct
ggacgtgtcggagctcctggtctccaaggagaacgaggtgaaaagggaactcgaggagaa
aagggagagcgaggcctggatggattccctgggaagcctggggacacaggacagcagggc
aggcccggcccttctggtgtggcaggaccccagggagaaaagggtgacgtgggacctgcg
gggccacctggtgtaccaggctcagtggtgcagcaagagggcttgaaaggggaacaggga
gctccaggacccagaggtcaccaaggcgcccccggtcctccaggagctcggggtccaata
ggcccagaaggcagggatggacctcctggtttgcaaggtctccgagggaagaaaggtgac
atgggaccacctggaatccctggattgctggggctgcagggccctccaggaccccctggt
gtcccaggcccccctggaccgggaggttctccgggtttgcctggagagatcggcttcccg
ggaaagcctggacctcctgggcccacgggaccccctggaaaggacgggccaaatggacca
ccaggtccgccaggaaccaagggagaaccaggagaaagaggggaagatggtctgcctgga
aaaccaggccttcggggagaaattggggagcagggcctggcaggccgacctggagagaag
ggagaagcaggcctcccaggggctccaggcttcccaggtgtgagaggagagaaaggagac
cagggagaaaaaggtgaactgggacttccaggactgaaaggtgaccgaggtgaaaagggt
gaagctggtcctgcaggccctcccgggttacctggaactacatccctgttcacaccacat
ccacggatgcccggagaacaagggcccaaaggagagaagggcgatccaggcctgcctggg
gaaccgggactgcagggccgtcctggagaattggggcctcagggacccactggaccaccg
ggtgccaagggacaggaaggtgcacatggggctcctggagcagctggaaaccccggtgct
cccggacatgtcggtgcccccggtcccagtggccctccaggaagtgtgggtgctcccggc
ctcagaggcaccccagggaaagatggggagcgtggtgagaagggtgcagcgggggaagaa
ggcagcccagggccagttggtcccaggggagatcctggtgctcctgggctccctgggcca
cccggaaaagggaaggatggagagccgggactccgtggatcacctggactccctggaccc
ctaggaaccaaggctgcttgcggaaaagtcagagggtcagaaaactgtgcactgggaggg
caatgtgttaagggggatcgaggagctcctgggatccctggttctcctggcagccgtggt
gacccaggcattggggttgctggccctcctggcccttccggaccaccaggagacaaagga
tccccgggatcacgaggcttacctggattccctggcccccagggcccagccggccgggac
ggtgcaccaggaaatccaggagaaagagggcctcctggcaagccgggcctctcttcacta
ctgtctccaggggacataaatctcttggctaaggatgtgtgcaatgactgccctcctggc
cccccaggcctccctggtctaccaggttttaaaggggacaaaggtgtcccaggaaagcca
gggagagaaggcacagaagggaaaaagggagaggctgggcctccaggcctaccagggccc
ccaggaatagctggaccacagggaagtcaaggagaacgtggtgcagatggtgaggttggg
cagaaaggtgatcagggtcatcctggagttccaggtttcatggggcccccagggaaccct
gggccaccaggggcagatggaattgcaggagctgctggaccaccaggaatccaagggtca
cctgggaaagaaggccctcctggcccccaaggcccatctggattacccggaatcccagga
gaagaaggcaaagagggcagagatggaaagccgggtccccctggagagccgggcaaagca
ggagagccaggtctaccaggaccagagggtgcccgaggcccacctggcttcaagggacac
acaggcgattctggtgcacccggtccccggggagagtctggtgccatggggcttcctggt
caggaagggttaccaggaaaagatggtgacactggacccactgggccacagggtccccaa
ggaccaaggggcccaccgggcaagaatggatcaccgggatctccaggagagcctggccct
tcaggaacccctggccagaaaggaagcaaaggggaaaatggcagcccaggacttcctggc
ttcctgggtccccgtgggcctccgggagaaccaggagagaaaggagtcccaggcaaggag
ggggtccctgggaagcctggagagcctggattcaaaggagaaaggggagatcctgggatc
aaaggtgacaaaggacctcctggtggaaaaggccagcctggggaccctggaatcccaggc
cacaaaggccacacaggcctgatgggtccccaaggactacctggggagaatggaccagtt
ggacccccagggcctccaggccagccgggatttccaggactgaggggggagtctccatcc
atggaaaccctgcgtcggcttattcaagaagagctggggaagcagcttgaaaccagactc
gcctacctcctggcccagatgcccccggcgtacatgaagtcatctcaaggcagacctggg
cccccagggccccctggaaaagatgggcttccaggccgggccggccccatgggggagcca
ggtcgtcctgggcaggggggtctggaaggaccctctggacccataggtcccaaaggtgag
cgaggagccaaaggtgacccaggtgcacctggagttggcctccgaggcgagatgggaccc
cctggaatcccaggtcaacccggggaacctggctatgctaaagatggacttcctgggatc
cctggccctcaaggggagacaggaccagctggacatcctggcctcccaggacctcccggt
cccccaggccaatgtgacccttcccagtgtgcctacttcgccagccttgctgcccggccg
ggtaatgtgaagggtccctaa

DBGET integrated database retrieval system