KEGG   Homo sapiens (human): 169714Help
Entry
169714            CDS       T01001                                 

Gene name
QSOX2, QSCN6L1, SOXN
Definition
(RefSeq) quiescin sulfhydryl oxidase 2
  KO
K10758  
thiol oxidase [EC:1.8.3.2]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     169714 (QSOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6ZRP7(Tdark)
UniProt: 
Position
9q34.3
AA seq 698 aa AA seqDB search
MAAAGAAVARSPGIGAGPALRARRSPPPRAARLPRLLVLLAAAAVGPGAGGAARLYRAGE
DAVWVLDSGSVRGATANSSAAWLVQFYSSWCGHCIGYAPTWRALAGDVRDWASAIRVAAL
DCMEEKNQAVCHDYDIHFYPTFRYFKAFTKEFTTGENFKGPDRELRTVRQTMIDFLQNHT
EGSRPPACPRLDPIQPSDVLSLLDNRGSHYVAIVFESNSSYLGREVILDLIPYESIVVTR
ALDGDKAFLEKLGVSSVPSCYLIYPNGSHGLINVVKPLRAFFSSYLKSLPDVRKKSLPLP
EKPHKEENSEIVVWREFDKSKLYTVDLESGLHYLLRVELAAHKSLAGAELKTLKDFVTVL
AKLFPGRPPVKKLLEMLQEWLASLPLDRIPYNAVLDLVNNKMRISGIFLTNHIKWVGCQG
SRSELRGYPCSLWKLFHTLTVEASTHPDALVGTGFEDDPQAVLQTMRRYVHTFFGCKECG
EHFEEMAKESMDSVKTPDQAILWLWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACH
EEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSADQGDSSEGGTLARGEEEEKRLTPPEVS
HGDRDTQSVRPPGALGPRPALPESLHHSLDGKLQSLDGPGAHKEVGGAAPFLGVDFSSLD
MSLCVVLYVASSLFLMVMYFFFRVRSRRWKVKHHHPAV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccggggcggcggtggcgcgcagcccgggaatcggagcgggacctgcgctg
agagcccggcgctcgcccccgccgcgggccgcacggctgccgcggctgctagtgctgcta
gcggcggcggcggtggggccgggcgcgggcggtgcggcgcggctgtaccgcgcgggcgag
gacgccgtgtgggtgctggacagcggcagcgtgcgcggggccaccgccaacagctcggcc
gcgtggctcgtgcagttctactcgtcgtggtgtggccactgcatcggctacgcgcccact
tggcgggccctggctggggatgtgcgagactgggccagtgccattcgcgtcgcagctctg
gactgcatggaagagaagaaccaggccgtgtgccatgactacgacatccacttctacccc
accttccggtattttaaagcatttacaaaggagtttacaactggagaaaattttaaagga
cctgaccgagagctgcgaacagtcagacagacgatgattgacttcctgcagaaccacacg
gaaggaagccggccccctgcctgcccgcgcctagaccccattcagcccagtgatgttctt
tcccttcttgacaaccgtggcagccattacgtggctattgtctttgaaagcaacagctcc
taccttggacgggaggtgatcttagacctgatcccgtatgaaagcatcgtggtgacccga
gcactggacggggacaaagcatttctggagaaacttggtgtttcttcagtcccttcgtgt
tacctgatctacccaaatgggtcgcatggattgattaacgtcgtgaagcctctgcgggcc
ttcttttcgtcttatttgaagtcattgccggatgtgaggaaaaaatcgcttcccttgcct
gaaaagccacacaaagaagaaaattcagaaatcgtggtttggagagaatttgacaagtcg
aagctgtacacggtggacctggagtcagggctacactacctcctgcgggtggagctggca
gcccacaagtccctggccggagcagagctgaagacgctcaaggactttgtgactgtcttg
gccaagctgttccctggacggccgccagtcaagaagctgttggagatgctgcaggagtgg
ctggccagccttcccctggacaggatcccctacaacgccgtgcttgacctggtcaacaac
aagatgcggatttctggaatattccttactaatcacataaagtgggttggatgtcaagga
agccgatctgagttgaggggttacccgtgttctctctggaaactgttccacactttgact
gttgaagcctcgacccacccagatgcactggttggcacaggctttgaagacgacccccag
gctgtgctgcagacaatgaggaggtacgttcacaccttctttgggtgtaaggaatgtggt
gagcactttgaggaaatggctaaagaatccatggactcggtgaaaaccccagaccaagcc
atcctctggctgtggaagaagcataatatggtgaacggccgcctggcaggccatctgagt
gaggatccccggtttccaaagcttcagtggcccactccggacctctgcccagcctgccat
gaggaaattaagggcctggccagctgggatgaaggccacgtgctcacattcttgaagcag
cactatggccgcgacaacctcttagacacgtattccgcagaccagggggattccagtgaa
ggaggaaccctggccaggggtgaggaagaggagaaaagactcactcccccagaggtgtcc
catggagaccgagacacccagagcgtccgtccacctggtgcactgggccccaggcctgcc
cttccagagagcttgcatcacagcttggacgggaaactccagagtctggatgggcccggg
gcccacaaggaggtgggcggggccgcacccttcctcggggttgacttctccagcctggac
atgagtctctgtgtcgtgctgtacgtggcttcatccctgttcctcatggtgatgtacttc
ttcttccgggtgaggtccaggcggtggaaggtcaagcaccaccacccggccgtgtga

DBGET integrated database retrieval system