KEGG   Homo sapiens (human): 170506Help
Entry
170506            CDS       T01001                                 

Gene name
DHX36, DDX36, G4R1, MLEL1, RHAU
Definition
(RefSeq) DEAH-box helicase 36
  KO
K14442  
ATP-dependent RNA helicase DHX36 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    170506 (DHX36)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     170506 (DHX36)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     170506 (DHX36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H2U1(Tbio)
UniProt: 
Position
3q25.2
AA seq 1008 aa AA seqDB search
MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR
EIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPE
DHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTL
DQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQV
TQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRL
PRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDL
KVILMSATLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDVIEKIRYVPEQKEHRSQFKR
GFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIR
YIVLEEEDGAILVFLPGWDNISTLHDLLMSQVMFKSDKFLIIPLHSLMPTVNQTQVFKRT
PPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRK
GRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMD
PPSNEAVLLSIRHLMELNALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLT
IAASLSFKDPFVIPLGKEKIADARRKELAKDTRSDHLTVVNAFEGWEEARRRGFRYEKDY
CWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRNPKDPESNINSDNEKIIKAVICAGLY
PKVAKIRLNLGKKRKMVKVYTKTDGLVAVHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLY
DCTEVSPYCLLFFGGDISIQKDNDQETIAVDEWIVFQSPARIAHLVKELRKELDILLQEK
IESPHPVDWNDTKSRDCAVLSAIIDLIKTQEKATPRNFPPRFQDGYYS
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgactaccatcagaactggggccgtgatgggggtccccgcagctccggtggg
ggctatggaggggggccagcagggggtcatggaggtaaccgaggctccggaggaggcggc
ggcggcggagggggtggtcgaggcggcaggggccggcatcccgggcacctgaaaggccgc
gaaatcggcatgtggtacgcgaaaaaacaggggcagaagaacaaggaagcggagaggcaa
gagagagctgtagtacacatggatgaacgacgagaagaacaaattgtacagttactgaat
tctgttcaagcgaagaatgataaagagtcagaagcacagatatcctggtttgctcctgag
gatcatggatacggtactgaagtttctactaagaacacaccatgctcagagaacaaactt
gacatccaggaaaagaagttgataaatcaagaaaaaaaaatgtttagaatcaggaacaga
tcatatattgaccgagattctgagtatctcttgcaagaaaatgaaccagatggaacttta
gaccaaaaattattggaagatttacaaaagaaaaaaaatgaccttcggtatattgaaatg
cagcatttcagagaaaagctgccttcgtatggaatgcaaaaggaattggtaaatttaatt
gataaccatcaggtaacagtaataagtggtgaaactggttgtggcaaaaccactcaagtt
actcagttcattttggataactacattgaaagaggaaaaggatctgcttgcagaatagtt
tgtactcagccaagaagaattagtgccatttcagttgcggaaagagtagctgcagaaagg
gcagaatcttgtggcagtggtaatagtactggatatcaaattcgtctccagagtcggttg
ccaaggaaacagggttctatcttatactgtacaacaggaatcatccttcagtggctccag
tcagacccgtatttgtccagtgttagtcatatcgtacttgatgaaatccatgaaagaaat
ctgcagtcagatgttttaatgactgttgttaaagaccttctcaattttcgatctgacttg
aaagtaatattgatgagtgcaacattgaatgcagaaaagttttcagaatattttggtaac
tgtccaatgatacatatacctggttttacctttccggttgtggaatatcttttggaagat
gtaattgaaaaaataaggtatgttccagaacaaaaagaacacagatcccagtttaagagg
ggtttcatgcaagggcatgtaaatagacaagaaaaagaagaaaaagaagcaatatataaa
gaacgttggccagattatgtaagggaactgcgaagaaggtattctgcaagtactgtagat
gttatagaaatgatggaggatgataaagttgatctgaatttgattgttgccctcatccga
tacattgttttggaagaagaggatggtgcgatactggtctttctgccaggctgggacaat
atcagcactttacatgatctcttgatgtcacaagtaatgtttaaatcagataaattttta
attatacctttacattcactgatgcctacagttaaccagacacaggtgtttaaaagaacc
cctcctggtgttcggaaaatagtaattgctaccaacattgcggagactagcattaccata
gatgatgtcgtttatgtgatagatggaggaaaaataaaagagacgcattttgatactcag
aacaatatcagtacaatgtccgctgagtgggttagtaaagctaatgccaaacagagaaaa
ggtcgagctggaagagttcaacctggtcattgctatcatctgtataatggtcttagagca
agtcttctagatgactatcaactgccagaaattttgagaactcctttggaagaactttgt
ttacaaataaagattttaaggctaggtggaattgcttattttctgagtagattaatggac
ccaccatcaaatgaggcagtgttactctccataagacacctgatggagctgaacgctttg
gataaacaagaagaattgacacctcttggagtccacttggcacgattacccgttgagcca
catattggaaaaatgattctttttggagcactgttctgctgcttagacccagtactcact
attgctgctagtctcagtttcaaagatccatttgtcattccactgggaaaagaaaagatt
gcagatgcaagaagaaaggaattggcaaaggatactagaagtgatcacttaacagttgtg
aatgcgtttgagggctgggaagaggctaggcgacgtggtttcagatacgaaaaggactat
tgctgggaatattttctgtcttcaaacacactgcagatgctgcataacatgaaaggacag
tttgctgagcatcttcttggagctggatttgtaagcagtagaaatcctaaagatccagaa
tctaatataaattcagataatgagaagataattaaagctgtcatctgtgctggtttatat
cccaaagttgctaaaattcgactaaatttgggtaaaaaaagaaaaatggtaaaagtttac
acaaaaaccgatggcctggttgctgttcatcctaaatctgttaatgtggagcaaacagac
tttcactacaactggcttatctatcacctaaagatgagaacaagcagtatatacttgtat
gactgcacagaggtttccccatactgtctcttgttttttggaggtgacatttccatccag
aaggataacgatcaggaaactattgctgtagatgagtggattgtatttcagtctccagca
agaattgcccatcttgttaaggaattaagaaaggaactagatattcttctgcaagagaag
attgaaagtcctcatcctgtagactggaatgacactaaatccagagactgtgcagtactg
tcagctattatagacttgatcaaaacacaggaaaaggcaactcccaggaactttccgcca
cgattccaggatggatattacagctga

DBGET integrated database retrieval system