KEGG   Homo sapiens (human): 170572Help
Entry
170572            CDS       T01001                                 

Gene name
HTR3C
Definition
(RefSeq) 5-hydroxytryptamine receptor 3C
  KO
K04819  
5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Serotonergic synapse
Taste transduction
Drug target
Alosetron (DG00046): 
Azasetron (DG01521): 
Batanopride hydrochloride: 
Cilansetron (DG00047): 
Dazopride fumarate: 
Dolasetron (DG00063): 
Fabesetron hydrochloride: 
Granisetron (DG00061): 
Indisetron hydrochloride: 
Itasetron (DG01240): 
Metergoline: 
Metoclopramide (DG00055): 
Mirtazapine: 
Ondansetron (DG00060): 
Palonosetron (DG00064): 
Pancopride: 
Quipazine maleate: 
Ramosetron (DG01239): 
Renzapride: 
Tedatioxetine (DG01311): 
Tropanserin hydrochloride: 
Tropisetron (DG00062): 
Vortioxetine (DG00965): 
Zacopride hydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    170572 (HTR3C)
  Sensory system
   04742 Taste transduction
    170572 (HTR3C)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Serotonin (5-HT3)
   170572 (HTR3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27.1
AA seq 447 aa AA seqDB search
MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNY
SIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENL
WLPDIFIVESMDVDQTPSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTF
SSFLYTVDSMLLGMDKEVWEITDTSRKVIQTQGEWELLGINKATPKMSMGNNLYDQIMFY
VAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGYNVFLLMMNDLL
PASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSLLLHCTSPGRC
CPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH
AMDTLLFRLYLLFMASSILTVIVLWNT
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagggtggcctgcaaggcagagtgccctcctctgcctcactgtcagtcttctg
cttcaaggaagaggcgacgcttttaccatcaattgctcaggctttgaccagcatggggtt
gaccctgctgtcttccaagcagtgtttgacagaaaggccttccgtccattcaccaactac
agcatccctacccgtgtcaacatctccttcaccctgtctgccatcctgggagtggatgca
cagctccagctgctgacatcattcctgtggatggatttggtatgggacaatcctttcatt
aattggaacccaaaagagtgtgttggcatcaataaactcacagtattagctgaaaacctg
tggctcccagacatcttcatcgtggaatccatggatgtggatcagacgccttccggtctc
actgcctatatcagcagtgaaggtcgaattaagtatgataagccaatgagggtgaccagc
atctgtaacctggacatcttctacttcccttttgaccaacagaactgtaccttcaccttc
agttctttcctctacacagtggacagcatgctgctgggcatggacaaggaggtgtgggag
atcacagacacgtctcgcaaagtcatccaaacccagggggagtgggagctcttgggcatc
aacaaggccaccccaaagatgtccatgggcaacaacctatatgaccagatcatgttttat
gtggccatcaggcgcaggccaagcctctacatcataaacctgctggtgcccagtagcttt
ctggttgccattgatgccctcagcttctacctgccagcagagagcgagaatcgtgcccca
ttcaagataacacttctgctgggctacaacgtcttcctgctcatgatgaatgacttgctc
cctgccagtggcacccccctcatcagtgtctacttcgccctgtgcctgtccctgatggtg
gtcagcctgctggagaccgtcttcattacctacctgctgcacgtggccaccacccagccc
ccacccatgcctaggtggcttcactccctgctgctccactgcaccagcccagggagatgc
tgtcccactgcgccccagaagggaaataagggcctgggtctcaccctcacccacctgcct
ggcccaaaggagccgggggagttagcagggaagaagctgggacccagagagaccgagcca
gatgggggctcaggatggacaaagacccagctaatggagctgtgggtgcagttcagccac
gcgatggacaccctgctcttccgcctctacctgctcttcatggcctcctccatccttact
gtcattgtcctctggaacacctag

DBGET integrated database retrieval system