KEGG   Homo sapiens (human): 170712Help
Entry
170712            CDS       T01001                                 

Gene name
COX7B2
Definition
cytochrome c oxidase subunit VIIb2 (EC:1.9.3.1)
Orthology
K02271  
cytochrome c oxidase subunit 7b
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p12
AA seq 81 aa AA seqDB search
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttcccttggccagaaatgcactaagcagtctcaagattcaaagcattctgcaa
agcatggcaagacatagccatgtaaaacactcaccagattttcatgataaatatggtaat
gctgtgctagccagtggaactgctttctgtgttgctacatgggtgtttacagccactcag
attggaatagaatggaacctatcccctgttggcagagttaccccaaaagagtggaaacat
cagtaa

DBGET integrated database retrieval system