KEGG   Homo sapiens (human): 170712Help
Entry
170712            CDS       T01001                                 

Gene name
COX7B2
Definition
(RefSeq) cytochrome c oxidase subunit 7B2
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    170712 (COX7B2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    170712 (COX7B2)
  Environmental adaptation
   04714 Thermogenesis
    170712 (COX7B2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    170712 (COX7B2)
   05012 Parkinson's disease
    170712 (COX7B2)
   05016 Huntington's disease
    170712 (COX7B2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    170712 (COX7B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7B Deltameth_res
Motif
Other DBs
NCBI-GeneID: 170712
NCBI-ProteinID: NP_570972
OMIM: 609811
HGNC: 24381
Ensembl: ENSG00000170516
Vega: OTTHUMG00000099423
Pharos: Q8TF08(Tdark)
UniProt: Q8TF08
Position
4p12
AA seq 81 aa AA seqDB search
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttcccttggccagaaatgcactaagcagtctcaagattcaaagcattctgcaa
agcatggcaagacatagccatgtaaaacactcaccagattttcatgataaatatggtaat
gctgtgctagccagtggaactgctttctgtgttgctacatgggtgtttacagccactcag
attggaatagaatggaacctatcccctgttggcagagttaccccaaaagagtggaaacat
cagtaa

DBGET integrated database retrieval system