KEGG   Homo sapiens (human): 170712Help
Entry
170712            CDS       T01001                                 

Gene name
COX7B2
Definition
cytochrome c oxidase subunit VIIb2 (EC:1.9.3.1)
Orthology
K02271  
cytochrome c oxidase subunit 7b
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    170712 (COX7B2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    170712 (COX7B2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    170712 (COX7B2)
   05012 Parkinson's disease
    170712 (COX7B2)
   05016 Huntington's disease
    170712 (COX7B2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    170712 (COX7B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p12
AA seq 81 aa AA seqDB search
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttcccttggccagaaatgcactaagcagtctcaagattcaaagcattctgcaa
agcatggcaagacatagccatgtaaaacactcaccagattttcatgataaatatggtaat
gctgtgctagccagtggaactgctttctgtgttgctacatgggtgtttacagccactcag
attggaatagaatggaacctatcccctgttggcagagttaccccaaaagagtggaaacat
cagtaa

DBGET integrated database retrieval system