KEGG   Homo sapiens (human): 170850Help
Entry
170850            CDS       T01001                                 

Gene name
KCNG3, KV10.1, KV6.3
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily G member 3
  KO
K04902  
potassium voltage-gated channel subfamily G member 3
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNG, Kv6.x
   170850 (KCNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p21
AA seq 436 aa AA seqDB search
MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNE
YFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRM
SDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVF
VIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRF
IVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVI
KLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSI
PAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK
FRSARYSRSLSTEFLN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgggcgcagcggggcggcctcggtggtgctgaacgtgggcggcgcccggtat
tcgctgtcccgggagctgctgaaggacttcccgctgcgccgcgtgagccggctgcacggc
tgccgctccgagcgcgacgtgctcgaggtgtgcgacgactacgaccgcgagcgcaacgag
tacttcttcgaccggcactcggaggccttcggcttcatcctgctctacgtgcgcggccac
ggcaagctgcgcttcgcgccgcggatgtgcgagctctccttctacaacgagatgatctac
tggggcctggagggcgcgcacctcgagtactgctgccagcgccgcctcgacgaccgcatg
tccgacacctacaccttctactcggccgacgagccgggcgtgctgggccgcgacgaggcg
cgccccggcggggccgaggcggctccctccaggcgctggctggagcgcatgcggcggacc
ttcgaggagcccacgtcgtcgctggccgcgcagatcctggctagcgtgtcggtggtgttc
gtgatcgtgtccatggtggtgctgtgcgccagcacgttgcccgactggcgcaacgcagcc
gccgacaaccgcagcctggatgaccggagcaggtactccgccggccctgggagggagccc
tccgggataattgaagctatctgcataggttggttcactgccgagtgcatcgtgaggttc
attgtctccaaaaacaagtgtgagtttgtcaagagacccctgaacatcattgatttactg
gcaatcacgccgtattacatctctgtgttgatgacagtgtttacaggcgagaactctcaa
ctccagagggctggagtcaccttgagggtacttagaatgatgaggattttttgggtgatt
aagcttgcccgtcacttcattggtcttcagacactcggtttgactctcaaacgttgctac
cgagagatggttatgttacttgtcttcatttgtgttgccatggcaatctttagtgcactt
tctcagcttcttgaacatgggctggacctggaaacatccaacaaggactttaccagcatt
cctgctgcctgctggtgggtgattatctctatgactacagttggctatggagatatgtat
cctatcacagtgcctggaagaattcttggaggagtttgtgttgtcagtggaattgttcta
ttggcattacctatcacttttatctaccatagctttgtgcagtgttatcatgagctcaag
tttagatctgctaggtatagtaggagcctctccactgaattcctgaattaa

DBGET integrated database retrieval system