KEGG   Homo sapiens (human): 171558Help
Entry
171558            CDS       T01001                                 

Gene name
PTCRA, PT-ALPHA, PTA
Definition
pre T-cell antigen receptor alpha
Orthology
K06056  
pre T-cell antigen receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Transcriptional misregulation in cancer
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 296 aa AA seqDB search
MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSP
IWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRST
QPMHLSGEASTARTCPQEPLRGGCGLLRAPERFLLAGTPGGALWLGVLRLLLFKLLLFDL
LLTCSCLCDPAGPLPSPATTTRLRALGSHRLHPATETGGREATSSPRPQPRDRRWGDTPP
GRKPGSPVWGEGSYLSSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGAA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggccggtacatggctgctacttctcctggcccttgggtgtccagccctacccacaggt
gtgggcggcacaccctttccttctctggccccaccaatcatgctgctggtggatggaaag
cagcagatggtggtggtctgcctggtccttgatgttgcaccccctggccttgacagcccc
atctggttctcagccggcaatggcagtgcactggatgccttcacctatggcccttcccca
gcaacggatggcacctggaccaacttggcccatctctccctgccttctgaggagctggca
tcctgggagcctttggtctgccacactgggcctggggctgagggtcacagcaggagtaca
cagcccatgcatctgtcaggagaggcttctacagccaggacctgcccccaggagcctctc
agggggggctgcgggctcctgcgggctcctgagcggttcctcctcgcagggacaccgggt
ggggcgctgtggctgggggtcctgcggctgctgctcttcaagctgctgctgtttgacctg
ctcctgacctgcagctgcctgtgcgaccccgcgggcccgctgccttcccccgcaaccacc
acccgcctgcgagccctcggctcccatcgactgcacccggccacggagactgggggacga
gaggccaccagctcacccagaccccagcctcgggaccgccgctggggtgacacccctccg
ggtcggaagcccgggagcccagtatggggggaagggtcttacctcagcagttaccccact
tgcccagcacaggcctggtgctcaagatctgccctcagggctccttcctccagtcttgga
gcattttttgcaggtgacctgcctcctcctctgcaggctggagctgcctga

DBGET integrated database retrieval system