KEGG   Homo sapiens (human): 1718Help
Entry
1718              CDS       T01001                                 

Gene name
DHCR24, DCE, Nbla03646, SELADIN1, seladin-1
Definition
(RefSeq) 24-dehydrocholesterol reductase
  KO
K09828  
Delta24-sterol reductase [EC:1.3.1.72 1.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Disease
H00617  
Desmosterolosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    1718 (DHCR24)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.72  Delta24-sterol reductase
     1718 (DHCR24)
    1.3.1.-  
     1718 (DHCR24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q15392(Tbio)
UniProt: 
Position
1p32.3
AA seq 516 aa AA seqDB search
MEPAVSLAVCALLFLLWVRLKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKL
SSAPRLHEQRVRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMD
ILEVDTKKQIVRVEPLVTMGQVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKY
GLFQHICTAYELVLADGSFVRCTPSENSDLFYAVPWSCGTLGFLVAAEIRIIPAKKYVKL
RFEPVRGLEAICAKFTHESQRQENHFVEGLLYSLDEAVIMTGVMTDEAEPSKLNSIGNYY
KPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVP
PKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQ
PGLVHPKGNEAELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
FWEMFDGSLYHKLREKLGCQDAFPEVYDKICKAARH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccgtgtcgctggccgtgtgcgcgctgctcttcctgctgtgggtgcgcctg
aaggggctggagttcgtgctcatccaccagcgctgggtgttcgtgtgcctcttcctcctg
ccgctctcgcttatcttcgatatctactactacgtgcgcgcctgggtggtgttcaagctc
agcagcgctccgcgcctgcacgagcagcgcgtgcgggacatccagaagcaggtgcgggaa
tggaaggagcagggtagcaagaccttcatgtgcacggggcgccctggctggctcactgtc
tcactacgtgtcgggaagtacaagaagacacacaaaaacatcatgatcaacctgatggac
attctggaagtggacaccaagaaacagattgtccgtgtggagcccttggtgaccatgggc
caggtgactgccctgctgacctccattggctggactctccccgtgttgcctgagcttgat
gacctcacagtggggggcttgatcatgggcacaggcatcgagtcatcatcccacaagtac
ggcctgttccaacacatctgcactgcttacgagctggtcctggctgatggcagctttgtg
cgatgcactccgtccgaaaactcagacctgttctatgccgtaccctggtcctgtgggacg
ctgggtttcctggtggccgctgagatccgcatcatccctgccaagaagtacgtcaagctg
cgtttcgagccagtgcggggcctggaggctatctgtgccaagttcacccacgagtcccag
cggcaggagaaccacttcgtggaagggctgctctactccctggatgaggctgtcattatg
acaggggtcatgacagatgaggcagagcccagcaagctgaatagcattggcaattactac
aagccgtggttctttaagcatgtggagaactatctgaagacaaaccgagagggcctggag
tacattcccttgagacactactaccaccgccacacgcgcagcatcttctgggagctccag
gacattatcccctttggcaacaaccccatcttccgctacctctttggctggatggtgcct
cccaagatctccctcctgaagctgacccagggtgagaccctgcgcaagctgtacgagcag
caccacgtggtgcaggacatgctggtgcccatgaagtgcctgcagcaggccctgcacacc
ttccaaaacgacatccacgtctaccccatctggctgtgtccgttcatcctgcccagccag
ccaggcctagtgcaccccaaaggaaatgaggcagagctctacatcgacattggagcatat
ggggagccgcgtgtgaaacactttgaagccaggtcctgcatgaggcagctggagaagttt
gtccgcagcgtgcatggcttccagatgctgtatgccgactgctacatgaaccgggaggag
ttctgggagatgtttgatggctccttgtaccacaagctgcgagagaagctgggttgccag
gacgccttccccgaggtgtacgacaagatctgcaaggccgccaggcactga

DBGET integrated database retrieval system