KEGG   Homo sapiens (human): 1727Help
Entry
1727              CDS       T01001                                 

Gene name
CYB5R3, B5R, DIA1
Definition
cytochrome b5 reductase 3 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Disease
H00235  
Methemoglobinemia
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 301 aa AA seqDB search
MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRF
RFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD
RAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFV
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccagctcagcacgttgggccatatggtgctcttcccagtctggttcctgtac
agtctgctcatgaagctgttccagcgctccacgccagccatcaccctcgagagcccggac
atcaagtacccgctgcggctcatcgaccgggagatcatcagccatgacacccggcgcttc
cgctttgccctgccgtcaccccagcacatcctgggcctccctgtcggccagcacatctac
ctctcggctcgaattgatggaaacctggtcgtccggccctatacacccatctccagcgat
gatgacaagggcttcgtggacctggtcatcaaggtttacttcaaggacacccatcccaag
tttcccgctggagggaagatgtctcagtacctggagagcatgcagattggagacaccatt
gagttccggggccccagtgggctgctggtctaccagggcaaagggaagttcgccatccga
cctgacaaaaagtccaaccctatcatcaggacagtgaagtctgtgggcatgatcgcggga
gggacaggcatcaccccgatgctgcaggtgatccgcgccatcatgaaggaccctgatgac
cacactgtgtgccacctgctctttgccaaccagaccgagaaggacatcctgctgcgacct
gagctggaggaactcaggaacaaacattctgcacgcttcaagctctggtacacgctggac
agagcccctgaagcctgggactacggccagggcttcgtgaatgaggagatgatccgggac
caccttccacccccagaggaggagccgctggtgctgatgtgtggccccccacccatgatc
cagtacgcctgccttcccaacctggaccacgtgggccaccccacggagcgctgcttcgtc
ttctga

DBGET integrated database retrieval system