KEGG   Homo sapiens (human): 1729Help
Entry
1729              CDS       T01001                                 

Gene name
DIAPH1, DFNA1, DIA1, DRF1, LFHL1, SCBMS, hDIA1
Definition
(RefSeq) diaphanous related formin 1
  KO
K05740  
diaphanous 1
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Regulation of actin cytoskeleton
AGE-RAGE signaling pathway in diabetic complications
Shigellosis
Disease
H00604  
Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1729 (DIAPH1)
  Cellular commiunity
   04510 Focal adhesion
    1729 (DIAPH1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1729 (DIAPH1)
  Infectious diseases
   05131 Shigellosis
    1729 (DIAPH1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     1729 (DIAPH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31
AA seq 1272 aa AA seqDB search
MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLD
GLKSGTTIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRV
QLNVFDEQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAK
AAELEKKLDSELTARHELQVEMKKMESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAE
VSQLTGEVAKLTKELEDAKKEMASLSAAAITVPPSVPSRAPVPPAPPLPGDSGTIIPPPP
APGDSTTPPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEG
VGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPL
PGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPEVQLR
RPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKS
VQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPE
PEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSV
TAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLL
HFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAAT
DEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHN
FRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMD
SLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTI
LEEAKELVGRAS
NT seq 3819 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcccggcgggagcctggggcccggccgcgggacccgggacaagaagaagggc
cggagcccagatgagctgccctcggcgggcggcgacggcggcaaatctaagaaatttact
ctgaagcggctcatggcagatgagctggagagatttaccagcatgagaattaagaaggag
aaggaaaagcccaattctgctcatagaaattcttctgcatcatatggggatgatcccaca
gcacagtcattgcaagatgtttcagatgaacaagtgctggttctctttgaacagatgctg
ctggatatgaacctgaatgaggagaaacagcaacctttgagggagaaggacatcatcatc
aagagggagatggtgtcccaatacttgtacacctccaaggctggcatgagccagaaggag
agctctaagtctgccatgatgtatattcaggagttgaggtcaggcttgcgggatatgcct
ctgctcagctgcctggagtcccttcgtgtgtctctcaacaacaaccctgtcagttgggtg
caaacatttggtgctgaaggcttggcctccttattggacattcttaaacgacttcatgat
gagaaagaagagactgctgggagttacgatagccggaacaagcatgagatcattcgctgc
ttgaaagcttttatgaacaacaagtttggaatcaagaccatgttggagacagaagaagga
atcctactgctggtcagagccatggatcctgctgttcccaacatgatgattgatgcagct
aagctgctttctgctctttgtattctaccgcagccagaggacatgaatgaaagggttttg
gaggcaatgacagaaagagctgagatggatgaagtggaacgtttccagccgctgctggat
ggattaaaaagtggaaccactattgcactgaaggttggatgcctacagctgatcaatgct
ctcatcacaccagcggaggaacttgacttccgagttcacatcagaagtgaactgatgcgt
ttggggctacatcaggtgttgcaggaccttcgagagattgaaaatgaagatatgagagtg
caactaaatgtgtttgatgaacaaggggaagaggattcctatgacctgaagggacggctg
gatgacattcgcatggagatggatgactttaatgaagtctttcagattctcttaaacaca
gtgaaggattcaaaggcagagccacacttcctttccatcctgcagcacttactcttggtc
cgaaatgactatgaggccagacctcagtactataagttgattgaagaatgtatttcccag
atagttctgcacaagaacggggctgatcctgacttcaagtgccggcacctccagattgag
attgagggattaattgatcaaatgattgataagacaaaggtggagaaatctgaagccaaa
gctgcagagctggaaaagaagttggactcagagttaacagcccgacatgagctacaggtg
gaaatgaaaaagatggaaagtgactttgagcagaagcttcaagatcttcagggagaaaaa
gatgcactgcattctgaaaagcagcaaattgccacagagaaacaggacctggaagcagag
gtgtcccagctcacaggagaggttgccaagctgacaaaggaactggaagatgccaagaaa
gaaatggcttccctctctgcggcagctattactgtacctccttctgttcctagtcgtgct
cctgttccccctgcccctcctttacctggtgactctggcactattattccaccaccacct
gctcctggggatagtaccactcctcctcctcctcctcctcctcctcctcctccacctcct
ttgcctgggggtgtttgcatctcctcacccccttctttacctggaggtactgctatctct
ccaccccctcctttgtctggggatgctaccatccctccaccccctcctttgcctgagggt
gttggcatcccttcaccctcttctttgcctggaggtactgccatccccccacctcctcct
ttgcctgggagtgctagaatccccccaccaccacctcctttgcctgggagtgctggaatt
ccccccccacctcctcccttgcctggagaagcaggaatgccacctcctcctccccctctt
cctggtggtcctggaatccctccacctcctccatttcccggaggccctggcattcctcca
cctccacccggaatgggtatgcctccacctcccccatttggatttggagttcctgcagcc
ccagttctgccatttggattaacccccaaaaagctttataagccagaggtgcagctccgg
aggccaaactggtccaagcttgtggctgaggacctctcccaggactgcttctggacaaag
gtgaaggaggaccgctttgagaacaatgaacttttcgccaaacttacccttaccttctct
gcccagaccaagacttccaaagccaagaaggatcaagaaggtggagaagaaaagaaatct
gtgcaaaagaaaaaagtaaaagagttaaaggtgttggattcaaagacagcccagaatctc
tcaatctttttgggttccttccgcatgccctatcaagagattaagaatgtcatcctggag
gtgaatgaggctgttctgactgagtctatgatccagaacctcattaagcaaatgccagag
ccagagcagttaaaaatgctttctgaactgaaggatgaatatgatgacctggctgagtca
gagcagtttggcgtggtgatgggcactgtgccccgactgcggcctcgcctcaatgccatt
ctcttcaagctacaattcagcgagcaagtggagaatatcaagccagagattgtgtctgtc
actgctgcatgtgaggagttacgtaagagtgagagcttttccaatctcctagagattacc
ttgcttgttggaaattacatgaatgctggctccagaaatgctggtgcttttggcttcaat
atcagcttcctctgtaagcttcgagacaccaagtccacagatcagaagatgacgttgtta
cacttcttggctgagttgtgtgagaatgactatcccgatgtcctcaagtttccagacgag
cttgcccatgtggagaaagccagccgagtttctgctgaaaacttgcaaaagaacctagat
cagatgaagaaacaaatttctgatgtggaacgtgatgttcagaatttcccagctgccaca
gatgaaaaagacaagtttgttgaaaaaatgaccagctttgtgaaggatgcacaggaacag
tataacaagctgcggatgatgcattctaacatggagaccctctataaggagctgggcgag
tacttcctctttgaccccaagaagttgtctgttgaagaatttttcatggatcttcacaat
tttcggaatatgtttttgcaagcagtcaaggagaaccagaagcggcgggagacagaagaa
aagatgaggcgagcaaaactagccaaggagaaggcagagaaggagcggctagagaagcag
cagaagagagagcaactcatagacatgaatgcagagggcgatgagacaggtgtgatggac
agtcttctagaagccctgcagtcaggggcagcattccgacggaagagagggccccgtcaa
gccaacaggaaggccgggtgtgcagtcacatctctgctagcttcggagctgaccaaggat
gatgccatggctgctgttcctgccaaggtgtccaagaacagtgagacattccccacaatc
cttgaggaagccaaggagttggttggccgtgcaagctaa

DBGET integrated database retrieval system