KEGG   Homo sapiens (human): 1729Help
Entry
1729              CDS       T01001                                 

Gene name
DIAPH1, DFNA1, DIA1, DRF1, LFHL1, hDIA1
Definition
diaphanous-related formin 1
Orthology
K05740  
diaphanous 1
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Regulation of actin cytoskeleton
Shigellosis
Disease
H00604  
Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1729 (DIAPH1)
  Cellular commiunity
   04510 Focal adhesion
    1729 (DIAPH1)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    1729 (DIAPH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31
AA seq 1263 aa AA seqDB search
MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFLERFTSMRIKKEKEKPNSAHR
NSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIIIKREMVSQYL
YTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWVQTFGAEGLA
SLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMD
PAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTTIA
LKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRVQLNVFDEQG
EEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLVRNDYEARPQ
YYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAKAAELEKKLD
SELTARHELQVEMKKMESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAEVSQLTGEVA
KLTKELEDAKKEMASLSAAAITVPPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPP
PPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSL
PGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPP
PPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPEVQLRRPNWSKLVA
EDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGEEKKSVQKKKVKEL
KVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSE
LKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRK
SESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCEN
DYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEK
MTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFMDLHNFRNMFLQAV
KENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSG
AAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVG
RAS
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcccggcgggagcctggggcccggccgcgggacccgggacaagaagaagggc
cggagcccagatgagctgccctcggcgggcggcgacggcggcaaatctaagaaatttctg
gagagatttaccagcatgagaattaagaaggagaaggaaaagcccaattctgctcataga
aattcttctgcatcatatggggatgatcccacagcacagtcattgcaagatgtttcagat
gaacaagtgctggttctctttgaacagatgctgctggatatgaacctgaatgaggagaaa
cagcaacctttgagggagaaggacatcatcatcaagagggagatggtgtcccaatacttg
tacacctccaaggctggcatgagccagaaggagagctctaagtctgccatgatgtatatt
caggagttgaggtcaggcttgcgggatatgcctctgctcagctgcctggagtcccttcgt
gtgtctctcaacaacaaccctgtcagttgggtgcaaacatttggtgctgaaggcttggcc
tccttattggacattcttaaacgacttcatgatgagaaagaagagactgctgggagttac
gatagccggaacaagcatgagatcattcgctgcttgaaagcttttatgaacaacaagttt
ggaatcaagaccatgttggagacagaagaaggaatcctactgctggtcagagccatggat
cctgctgttcccaacatgatgattgatgcagctaagctgctttctgctctttgtattcta
ccgcagccagaggacatgaatgaaagggttttggaggcaatgacagaaagagctgagatg
gatgaagtggaacgtttccagccgctgctggatggattaaaaagtggaaccactattgca
ctgaaggttggatgcctacagctgatcaatgctctcatcacaccagcggaggaacttgac
ttccgagttcacatcagaagtgaactgatgcgtttggggctacatcaggtgttgcaggac
cttcgagagattgaaaatgaagatatgagagtgcaactaaatgtgtttgatgaacaaggg
gaagaggattcctatgacctgaagggacggctggatgacattcgcatggagatggatgac
tttaatgaagtctttcagattctcttaaacacagtgaaggattcaaaggcagagccacac
ttcctttccatcctgcagcacttactcttggtccgaaatgactatgaggccagacctcag
tactataagttgattgaagaatgtatttcccagatagttctgcacaagaacggggctgat
cctgacttcaagtgccggcacctccagattgagattgagggattaattgatcaaatgatt
gataagacaaaggtggagaaatctgaagccaaagctgcagagctggaaaagaagttggac
tcagagttaacagcccgacatgagctacaggtggaaatgaaaaagatggaaagtgacttt
gagcagaagcttcaagatcttcagggagaaaaagatgcactgcattctgaaaagcagcaa
attgccacagagaaacaggacctggaagcagaggtgtcccagctcacaggagaggttgcc
aagctgacaaaggaactggaagatgccaagaaagaaatggcttccctctctgcggcagct
attactgtacctccttctgttcctagtcgtgctcctgttccccctgcccctcctttacct
ggtgactctggcactattattccaccaccacctgctcctggggatagtaccactcctcct
cctcctcctcctcctcctcctcctccacctcctttgcctgggggtgtttgcatctcctca
cccccttctttacctggaggtactgctatctctccaccccctcctttgtctggggatgct
accatccctccaccccctcctttgcctgagggtgttggcatcccttcaccctcttctttg
cctggaggtactgccatccccccacctcctcctttgcctgggagtgctagaatcccccca
ccaccacctcctttgcctgggagtgctggaattccccccccacctcctcccttgcctgga
gaagcaggaatgccacctcctcctccccctcttcctggtggtcctggaatccctccacct
cctccatttcccggaggccctggcattcctccacctccacccggaatgggtatgcctcca
cctcccccatttggatttggagttcctgcagccccagttctgccatttggattaaccccc
aaaaagctttataagccagaggtgcagctccggaggccaaactggtccaagcttgtggct
gaggacctctcccaggactgcttctggacaaaggtgaaggaggaccgctttgagaacaat
gaacttttcgccaaacttacccttaccttctctgcccagaccaagacttccaaagccaag
aaggatcaagaaggtggagaagaaaagaaatctgtgcaaaagaaaaaagtaaaagagtta
aaggtgttggattcaaagacagcccagaatctctcaatctttttgggttccttccgcatg
ccctatcaagagattaagaatgtcatcctggaggtgaatgaggctgttctgactgagtct
atgatccagaacctcattaagcaaatgccagagccagagcagttaaaaatgctttctgaa
ctgaaggatgaatatgatgacctggctgagtcagagcagtttggcgtggtgatgggcact
gtgccccgactgcggcctcgcctcaatgccattctcttcaagctacaattcagcgagcaa
gtggagaatatcaagccagagattgtgtctgtcactgctgcatgtgaggagttacgtaag
agtgagagcttttccaatctcctagagattaccttgcttgttggaaattacatgaatgct
ggctccagaaatgctggtgcttttggcttcaatatcagcttcctctgtaagcttcgagac
accaagtccacagatcagaagatgacgttgttacacttcttggctgagttgtgtgagaat
gactatcccgatgtcctcaagtttccagacgagcttgcccatgtggagaaagccagccga
gtttctgctgaaaacttgcaaaagaacctagatcagatgaagaaacaaatttctgatgtg
gaacgtgatgttcagaatttcccagctgccacagatgaaaaagacaagtttgttgaaaaa
atgaccagctttgtgaaggatgcacaggaacagtataacaagctgcggatgatgcattct
aacatggagaccctctataaggagctgggcgagtacttcctctttgaccccaagaagttg
tctgttgaagaatttttcatggatcttcacaattttcggaatatgtttttgcaagcagtc
aaggagaaccagaagcggcgggagacagaagaaaagatgaggcgagcaaaactagccaag
gagaaggcagagaaggagcggctagagaagcagcagaagagagagcaactcatagacatg
aatgcagagggcgatgagacaggtgtgatggacagtcttctagaagccctgcagtcaggg
gcagcattccgacggaagagagggccccgtcaagccaacaggaaggccgggtgtgcagtc
acatctctgctagcttcggagctgaccaaggatgatgccatggctgctgttcctgccaag
gtgtccaagaacagtgagacattccccacaatccttgaggaagccaaggagttggttggc
cgtgcaagctaa

DBGET integrated database retrieval system