KEGG   Homo sapiens (human): 1730Help
Entry
1730              CDS       T01001                                 

Gene name
DIAPH2, DIA, DIA2, DRF2, POF, POF2, POF2A
Definition
(RefSeq) diaphanous related formin 2
  KO
K05741  diaphanous 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Disease
H00627  Premature ovarian failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1730 (DIAPH2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     1730 (DIAPH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_FH3 Drf_GBD Drf_DAD Drf_FH1
Motif
Other DBs
NCBI-GeneID: 1730
NCBI-ProteinID: NP_006720
OMIM: 300108
HGNC: 2877
Ensembl: ENSG00000147202
Vega: OTTHUMG00000022689
Pharos: O60879(Tbio)
UniProt: O60879
Position
Xq21.33
AA seq 1101 aa AA seqDB search
MEQPGAAASGAGGGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRIT
SFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLN
EEKKAPLRNKDFTTKREMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISDEKLL
NCLESLRVSLTSNPVSWVNNFGHEGLGLLLDELEKLLDKKQQENIDKKNQYKLIQCLKAF
MNNKFGLQRILGDERSLLLLARAIDPKQPNMMTEIVKILSAICIVGEENILDKLLGAITT
AAERNNRERFSPIVEGLENQEALQLQVACMQFINALVTSPYELDFRIHLRNEFLRSGLKT
MLPDLKEKENDELDIQLKVFDENKEDDLTELSHRLNDIRAEMDDMNEVYHLLYNMLKDTA
AENYFLSILQHFLLIRNDYYIRPQYYKIIEECVSQIVLHCSGMDPDFKYRQRLDIDLTHL
IDSCVNKAKVEESEQKAAEFSKKFDEEFTARQEAQAELQKRDEKIKELEAEIQQLRTQAQ
VLSSSSGIPGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLF
GGPPPPPPLGGVPPPPGISLNLPYGMKQKKMYKPEVSMKRINWSKIEPTELSENCFWLRV
KEDKFENPDLFAKLALNFATQIKVQKNAEALEEKKTGPTKKKVKELRILDPKTAQNLSIF
LGSYRMPYEDIRNVILEVNEDMLSEALIQNLVKHLPEQKILNELAELKNEYDDLCEPEQF
GVVMSSVKMLQPRLSSILFKLTFEEHINNIKPSIIAVTLACEELKKSESFNRLLELVLLV
GNYMNSGSRNAQSLGFKINFLCKIRDTKSADQKTTLLHFIADICEEKYRDILKFPEELEH
VESASKVSAQILKSNLASMEQQIVHLERDIKKFPQAENQHDKFVEKMTSFTKTAREQYEK
LSTMHNNMMKLYENLGEYFIFDSKTVSIEEFFGDLNNFRTLFLEAVRENNKRREMEEKTR
RAKLAKEKAEQEKLERQKKKKQLIDINKEGDETGVMDNLLEALQSGAAFRDRRKRIPRNP
DNRRVPLERSRSRHNGAISSK
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcccggggcggcggcgtcgggagcgggaggcggcagcgaggaacccggtggg
ggccggagcaacaagcggagcgcggggaaccgggccgccaatgaagaggaaacgaaaaac
aaacccaaattgaacattcaaataaaaactttggcagatgatgtgcgtgaccgaattaca
agttttagaaaatctactgtcaaaaaagaaaaacctcttattcaacatcctattgattct
caagtcgcgatgagtgagtttcctgcagctcagccattatatgatgaacgatctttgaat
ttgtcagaaaaggaagtattggatctctttgaaaaaatgatggaggacatgaaccttaac
gaagagaaaaaagctcctttacgaaacaaagactttaccaccaaacgtgagatggttgtc
cagtatatttctgccactgccaaatctggtgggctgaaaaacagcaaacatgaatgcacc
ctgtcttcacaagaatatgttcatgaattacgatcgggtatatcagatgagaaacttctt
aattgcctagaatccctcagggtttctttaaccagcaatccggtcagctgggttaacaac
tttggccatgaaggtcttggactcttattggatgagctggaaaagcttctggacaaaaaa
cagcaagaaaatattgacaagaagaatcagtataaacttattcaatgcctcaaagcattt
atgaataataagtttggattacaaaggattctaggagatgaaagaagtcttttactattg
gcaagagcaattgaccccaaacaacccaacatgatgactgaaatagtaaaaatactttct
gctatttgcattgttggagaagagaacattctagataaacttttaggggctataacaaca
gcagcagaaagaaataacagggaacgattttcaccaattgtggaaggtttagaaaatcag
gaagccttgcaattacaggtggcctgcatgcagtttataaatgcccttgtcacttctcct
tatgagcttgattttcgaatacatttaaggaatgaattcctccgttcaggactaaaaaca
atgttaccagatctaaaagaaaaagagaatgatgagcttgatattcagttgaaagtattt
gatgaaaacaaagaagatgacctaactgaattatcacaccgtctcaatgacattcgagca
gaaatggatgatatgaatgaagtctaccatcttctatataatatgctgaaggacactgct
gctgaaaattacttcttatctattctacaacattttttgcttatcagaaatgattattat
atcaggccacaatattataaaataattgaggaatgtgtttcacagatagtgctacactgc
agtggtatggatccagacttcaaatacaggcaaagattagacatcgatttaactcatctg
atagattcttgtgtgaacaaggcgaaagttgaagaaagtgaacaaaaagctgcagagttt
tcaaagaagttcgatgaagaattcacagctcgacaggaagctcaagcagagcttcaaaaa
agagatgagaaaatcaaagaacttgaagcagaaatccagcaacttcgaacccaggcacaa
gtactctcaagttcatcaggaattccaggtcctcctgcagcacctccattgccaggtgta
gggccgcctccaccaccacccgcgccacctctacccggaggagctcctcttcctcctcca
ccacctcctttacctggaatgatggggataccaccaccacccccaccaccacttttattt
gggggacctcctccaccaccaccccttggaggagttcctcctcccccaggaatatcactt
aatctaccttatggaatgaagcagaaaaaaatgtataaacctgaagtgtccatgaagaga
atcaattggtcaaagattgaacccacagaattatctgagaactgtttctggttaagagtc
aaagaagacaagtttgagaatccagatctctttgccaaattggcattgaattttgctact
cagataaaagttcaaaagaacgcagaagcattagaagaaaagaagactgggcctacaaag
aagaaagtgaaagaactgagaattttggatcccaaaacagctcagaatctgtccatcttt
ctgggatcatatcgcatgccatatgaagacataagaaacgttattctggaggttaatgaa
gacatgctgagtgaggctttaattcagaaccttgtgaaacatcttcctgagcagaagata
ctcaacgaattagcagagcttaagaatgaatatgatgacctctgtgagcctgaacaattt
ggagttgtgatgagctctgtgaaaatgttacagcctcgtctcagtagtatcctgttcaag
ctcacatttgaagaacacataaacaacatcaaaccaagcatcatagcagtaactcttgcc
tgtgaagaactgaagaaaagtgaaagctttaacagacttttagagttagttcttcttgtt
ggaaactacatgaactcaggctcaagaaatgcccagtctttgggatttaagatcaacttc
ctttgtaagatcagagatactaaatcagcggatcaaaaaacaacccttttgcattttatt
gccgacatttgtgaggaaaaatatcgagatatcctaaaatttcctgaagaactggaacac
gtagaaagtgcaagcaaagtttcagctcaaattctcaagagcaaccttgcatcaatggaa
caacaaattgttcatctggaacgtgacatcaagaaattcccccaagcagaaaatcaacac
gataagtttgtggaaaagatgaccagctttacaaagactgcccgagaacagtatgaaaaa
ctctccaccatgcacaacaacatgatgaagctctatgagaatcttggagaatacttcatt
tttgactcaaagacagtgagcatagaagagttctttggtgatctcaacaacttccgaact
ttgtttttggaagcagtgagagaaaacaataagagaagagaaatggaagagaagaccagg
agggcaaaacttgcaaaagagaaagctgaacaagaaaagttagaacgccagaagaaaaag
aaacaactcattgatataaacaaagagggtgatgagactggtgtgatggataatcttcta
gaagccctacaatcaggtgcagcattcagagaccgtcgaaagcggattccaaggaatcca
gataacagacgagtacctttggaaaggtcacgctctcgccacaatggagctatctcatct
aagtga

DBGET integrated database retrieval system