KEGG   Homo sapiens (human): 1731Help
Entry
1731              CDS       T01001                                 

Gene name
SEPT1, DIFF6, LARP, PNUTL3, SEP1
Definition
septin 1 (EC:3.1.5.1)
Orthology
K13737  
septin 1
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1731 (SEPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.1
AA seq 414 aa AA seqDB search
MSHHDDGATVGLGIQMCEGWRVEAALSFLPHQRKWGETAGAVMAGGVMDKEYVGFAALPN
QLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRG
VEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSR
VHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKE
EEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVE
VENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSR
QSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaccacgatgatggagctacagtgggacttggaatccagatgtgtgaaggatgg
agggttgaagccgcactcagcttcctgccccaccagaggaagtggggagagacggcaggt
gcagtgatggctggcggagtcatggacaaggagtacgtgggttttgctgccctccccaac
cagctgcaccgcaagtctgtcaagaaggggtttgacttcacgctaatggtggcaggggag
tcaggcctagggaaatccaccctcatcaacagcctcttcctcaccaacctctatgaggat
cgccaggtgccagaggccagtgctcgcttgacacagaccctggccattgagcgccggggc
gtagagattgaggaagggggtgtgaaagtgaagctgacccttgtggacacacctggcttt
ggggactcagtggactgctctgactgctggcttccggtggtgaaattcatcgaggagcaa
tttgagcagtaccttagggatgagagtggcctgaaccggaagaacatccaggactcccga
gtccactgctgcctctacttcatctcacccttcggccgggggctccggcccctagatgtg
gccttcctccgggcagtacacgagaaagtcaacatcatcccagtcattggcaaagcggat
gctctgatgccccaggaaacccaggccctcaagcagaagatccgggatcagttgaaggaa
gaggagatccacatctaccagttccccgaatgtgactctgatgaagatgaagacttcaag
aggcaggatgcagagatgaaggaaagcatcccttttgcagtcgtgggatcatgcgaggtg
gtgagggatggcgggaaccggccggtgaggggacgccgctactcctgggggaccgtggag
gtggagaacccacatcactgcgatttcctgaacctgcgacggatgctggtgcagacacac
ctgcaggacctgaaagaggtgacgcacgatctgctctacgagggctaccgggcccgctgc
ctacagagcctggcccggcctggggctcgcgatcgagccagccgcagtaagctttcccgc
cagagcgccacagagatcccgctgcccatgctgcctctggcggacaccgagaagctgatc
cgcgagaaagacgaagagctgcgccgcatgcaagagatgctggagaagatgcaggcccaa
atgcagcagagccaggcccagggcgagcagtcagacgccctctga

DBGET integrated database retrieval system