KEGG   Homo sapiens (human): 1737Help
Entry
1737              CDS       T01001                                 

Gene name
DLAT, DLTA, PDC-E2, PDCE2
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00020  Citrate cycle (TCA cycle)
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  Pyruvate dehydrogenase complex deficiency
H01999  Pyruvate dehydrogenase E2 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    1737 (DLAT)
   00020 Citrate cycle (TCA cycle)
    1737 (DLAT)
   00620 Pyruvate metabolism
    1737 (DLAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     1737 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 1737
NCBI-ProteinID: NP_001922
OMIM: 608770
HGNC: 2896
Ensembl: ENSG00000150768
Vega: OTTHUMG00000133751
Pharos: P10515(Tbio)
UniProt: P10515 Q86YI5
Structure
PDB: 

Jmol
Position
11q23.1
AA seq 647 aa AA seqDB search
MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSAAPTPQAAPAPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
SAFADYRPTEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPL
AKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFI
IKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIAND
VVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcgcgacgggctcagaatgtagccccatgggcgggactcgaggct
cggtggacggccttgcaggaggtacccggaactccacgagtgacctcgcgatctggcccg
gctcccgctcgtcgcaacagcgtgactacagggtatggcggggtccgggcactgtgcggc
tggacccccagttctggggccacgccgcggaaccgcttactgctgcagcttttggggtcg
cccggccgccgctattacagtcttcccccgcatcagaaggttccattgccttctctttcc
cccacaatgcaggcaggcaccatagcccgttgggaaaaaaaagagggggacaaaatcaat
gaaggtgacctaattgcagaggttgaaactgataaagccactgttggatttgagagcctg
gaggagtgttatatggcaaagatacttgttgctgaaggtaccagggatgttcccatcgga
gcgatcatctgtatcacagttggcaagcctgaggatattgaggcctttaaaaattataca
ctggattcctcagcagcacctaccccacaagcggccccagcaccaacccctgctgccact
gcttcgccacctacaccttctgctcaggctcctggtagctcatatccccctcacatgcag
gtacttcttcctgccctctctcccaccatgaccatgggcacagttcagagatgggaaaaa
aaagtgggtgagaagctaagtgaaggagacttactggcagagatagaaactgacaaagcc
actataggttttgaagtacaggaagaaggttatctggcaaaaatcctggtccctgaaggc
acaagagatgtccctctaggaaccccactctgtatcattgtagaaaaagaggcagatata
tcagcatttgctgactataggccaaccgaagtaacagatttaaaaccacaagtgccacca
cctaccccacccccggtggccgctgttcctccaactccccagcctttagctcctacacct
tcagcaccctgcccagctactcctgctggaccaaagggaagggtgtttgttagccctctt
gcaaagaagttggcagtagagaaagggattgatcttacacaagtaaaagggacaggacca
gatggtagaatcaccaagaaggatatcgactcttttgtgcctagtaaagttgctcctgct
ccggcagctgttgtgcctcccacaggtcctggaatggcaccagttcctacaggtgtcttc
acagatatcccaatcagcaacattcgtcgggttattgcacagcgattaatgcaatcaaag
caaaccatacctcattattacctttctatcgatgtaaatatgggagaagttttgttggta
cggaaagaacttaataagatattagaagggagaagcaaaatttctgtcaatgacttcatc
ataaaagcttcagctttggcatgtttaaaagttcccgaagcaaattcttcttggatggac
acagttataagacaaaatcatgttgttgatgtcagtgttgcggtcagtactcctgcagga
ctcatcacacctattgtgtttaatgcacatataaaaggagtggaaaccattgctaatgat
gttgtttctttagcaaccaaagcaagagagggtaaactacagccacatgaattccagggt
ggcacttttacgatctccaatttaggaatgtttggaattaagaatttctctgctattatt
aacccacctcaagcatgtattttggcaattggtgcttcagaggataaactggtccctgca
gataatgaaaaagggtttgatgtggctagcatgatgtctgttacactcagttgtgatcac
cgggtggtggatggagcagttggagcccagtggcttgctgagtttagaaagtaccttgaa
aaacctatcactatgttgttgtaa

DBGET integrated database retrieval system