KEGG   Homo sapiens (human): 1739Help
Entry
1739              CDS       T01001                                 

Gene name
DLG1, DLGH1, SAP-97, SAP97, dJ1061C18.1.1, hdlg
Definition
discs, large homolog 1 (Drosophila)
Orthology
K12076  
disks large protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
T cell receptor signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1739 (DLG1)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    1739 (DLG1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1739 (DLG1)
  Infectious diseases
   05166 HTLV-I infection
    1739 (DLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q29
AA seq 904 aa AA seqDB search
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKPSEPIQPVNTWEISSLPSSTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDIT
NSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIIL
GPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIE
AGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIME
MNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPA
KEKL
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccggaagcaagatacccagagagcattgcaccttttggaggaatatcgttca
aaactaagccaaactgaagacagacagctcagaagttccatagaacgggttattaacata
tttcagagcaacctctttcaggctttaatagatattcaagaattttatgaagtgacctta
ctggataatccaaaatgtatagatcgttcaaagccgtctgaaccaattcaacctgtgaat
acttgggagatttccagccttccaagctctactgtgacttcagagacactgccaagcagc
cttagccctagtgtagagaaatacaggtatcaggatgaagatacacctcctcaagagcat
atttccccacaaatcacaaatgaagtgataggtccagaattggttcatgtctcagagaag
aacttatcagagattgagaatgtccatggatttgtttctcattctcatatttcaccaata
aagccaacagaagctgttcttccctctcctcccactgtccctgtgatccctgtcctgcca
gtccctgctgagaatactgtcatcctacccaccataccacaggcaaatcctcccccagta
ctggtcaacacagatagcttggaaacaccaacttacgttaatggcacagatgcagattat
gaatatgaagaaatcacacttgaaaggggaaattcagggcttggtttcagcattgcagga
ggtacggacaacccacacattggagatgactcaagtattttcattaccaaaattatcaca
gggggagcagccgcccaagatggaagattgcgggtcaatgactgtatattacgagtaaat
gaagtagatgttcgtgatgtaacacatagcaaagcagttgaagcgttgaaagaagcaggg
tctattgtacgcttgtatgtaaaaagaaggaaaccagtgtcagaaaaaataatggaaata
aagctcattaaaggtcctaaaggtcttgggtttagcattgctggaggtgttggaaatcag
catattcctggggataatagcatctatgtaaccaaaataattgaaggaggtgcagcacat
aaggatggcaaacttcagattggagataaacttttagcagtgaataacgtatgtttagaa
gaagttactcatgaagaagcagtaactgccttaaagaacacatctgattttgtttatttg
aaagtggcaaaacccacaagtatgtatatgaatgatggctatgcaccacctgatatcacc
aactcttcttctcagcctgttgataaccatgttagcccatcttccttcttgggccagaca
ccagcatctccagccagatactccccagtttctaaagcagtacttggagatgatgaaatt
acaagggaacctagaaaagttgttcttcatcgtggctcaacgggccttggtttcaacatt
gtaggaggagaagatggagaaggaatatttatttcctttatcttagccggaggacctgct
gatctaagtggagagctcagaaaaggagatcgtattatatcggtaaacagtgttgacctc
agagctgctagtcatgagcaggcagcagctgcattgaaaaatgctggccaggctgtcaca
attgttgcacaatatcgacctgaagaatacagtcgttttgaagctaaaatacatgattta
cgggagcagatgatgaatagtagtattagttcagggtcaggttctcttcgaactagccag
aagcgatccctctatgtcagagccctttttgattatgacaagactaaagacagtgggctt
cccagtcagggactgaacttcaaatttggagatatcctccatgttattaatgcttctgat
gatgaatggtggcaagccaggcaggttacaccagatggtgagagcgatgaggtcggagtg
attcccagtaaacgcagagttgagaagaaagaacgagcccgattaaaaacagtgaaattc
aattctaaaacgagagataaaggggagatccctgacgacatgggatcaaaaggcctgaag
catgtaacttctaatgccagcgatagtgaaagtagttaccgtggtcaagaagaatacgtc
ttatcttatgaaccagtgaatcaacaagaagttaattatactcgaccagtgatcatattg
ggacctatgaaagacaggataaatgatgacttgatctcagaatttcctgacaaatttgga
tcctgtgttcctcatacaactagaccaaaacgagattatgaggtagatggaagagattat
cattttgtgacttcaagagagcagatggaaaaagatatccaggaacataaattcattgaa
gctggccagtataacaatcatctatatggaacaagtgttcagtctgtacgagaagtagca
gaaaagggcaaacactgtatccttgatgtgtctggaaatgccataaagagattacagatt
gcacagctttaccctatctccatttttattaaacccaaatccatggaaaatatcatggaa
atgaataagcgtctaacagaagaacaagccagaaaaacatttgagagagccatgaaactg
gaacaggagtttactgaacatttcacagctattgtacagggggatacgctggaagacatt
tacaaccaagtgaaacagatcatagaagaacaatctggttcttacatctgggttccggca
aaagaaaagctatga

DBGET integrated database retrieval system