KEGG   Homo sapiens (human): 174Help
Entry
174               CDS       T01001                                 

Gene name
AFP, FETA, HPAFP
Definition
alpha-fetoprotein
Orthology
K16144  
alpha-fetoprotein
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    174 (AFP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13.3
AA seq 609 aa AA seqDB search
MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATY
KEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEG
RHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILL
WAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSLLNQHACAVMKNFGTRTFQAITV
TKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKIT
ECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSR
RHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ
KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADII
IGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQA
QGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLI
SKTRAALGV
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggtggaatcaatttttttaattttcctactaaattttactgaatccagaaca
ctgcatagaaatgaatatggaatagcttccatattggattcttaccaatgtactgcagag
ataagtttagctgacctggctaccatattttttgcccagtttgttcaagaagccacttac
aaggaagtaagcaaaatggtgaaagatgcattgactgcaattgagaaacccactggagat
gaacagtcttcagggtgtttagaaaaccagctacctgcctttctggaagaactttgccat
gagaaagaaattttggagaagtacggacattcagactgctgcagccaaagtgaagaggga
agacataactgttttcttgcacacaaaaagcccactccagcatcgatcccacttttccaa
gttccagaacctgtcacaagctgtgaagcatatgaagaagacagggagacattcatgaac
aaattcatttatgagatagcaagaaggcatcccttcctgtatgcacctacaattcttctt
tgggctgctcgctatgacaaaataattccatcttgctgcaaagctgaaaatgcagttgaa
tgcttccaaacaaaggcagcaacagttacaaaagaattaagagaaagcagcttgttaaat
caacatgcatgtgcagtaatgaaaaattttgggacccgaactttccaagccataactgtt
actaaactgagtcagaagtttaccaaagttaattttactgaaatccagaaactagtcctg
gatgtggcccatgtacatgagcactgttgcagaggagatgtgctggattgtctgcaggat
ggggaaaaaatcatgtcctacatatgttctcaacaagacactctgtcaaacaaaataaca
gaatgctgcaaactgaccacgctggaacgtggtcaatgtataattcatgcagaaaatgat
gaaaaacctgaaggtctatctccaaatctaaacaggtttttaggagatagagattttaac
caattttcttcaggggaaaaaaatatcttcttggcaagttttgttcatgaatattcaaga
agacatcctcagcttgctgtctcagtaattctaagagttgctaaaggataccaggagtta
ttggagaagtgtttccagactgaaaaccctcttgaatgccaagataaaggagaagaagaa
ttacagaaatacatccaggagagccaagcattggcaaagcgaagctgcggcctcttccag
aaactaggagaatattacttacaaaatgcgtttctcgttgcttacacaaagaaagccccc
cagctgacctcgtcggagctgatggccatcaccagaaaaatggcagccacagcagccact
tgttgccaactcagtgaggacaaactattggcctgtggcgagggagcggctgacattatt
atcggacacttatgtatcagacatgaaatgactccagtaaaccctggtgttggccagtgc
tgcacttcttcatatgccaacaggaggccatgcttcagcagcttggtggtggatgaaaca
tatgtccctcctgcattctctgatgacaagttcattttccataaggatctgtgccaagct
cagggtgtagcgctgcaaacgatgaagcaagagtttctcattaaccttgtgaagcaaaag
ccacaaataacagaggaacaacttgaggctgtcattgcagatttctcaggcctgttggag
aaatgctgccaaggccaggaacaggaagtctgctttgctgaagagggacaaaaactgatt
tcaaaaactcgtgctgctttgggagtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system