KEGG   Homo sapiens (human): 1741Help
Entry
1741              CDS       T01001                                 

Gene name
DLG3, MRX, MRX90, NEDLG, SAP102, XLMR
Definition
discs, large homolog 3 (Drosophila)
Orthology
K12075  
discs large protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Disease
H00480  
Non-syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1741 (DLG3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     1741 (DLG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq13.1
AA seq 366 aa AA seqDB search
MMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEW
WQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRSIKTKRKKSFRL
SRKFPFYKSKENMAQESSIQEQGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVI
ILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKF
IEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEAL
MEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWV
PSPEKL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacagcagcatgagctctgggtctgggtccctccgaacaagtgaaaagaggtcc
ttgtatgtcagggccctgtttgattatgatcggactcgggacagctgcctgccaagccag
gggctcagcttctcttatggtgacattctgcatgtcattaatgcctctgatgatgagtgg
tggcaggcaaggctggtgaccccacacggagaaagtgagcagatcggtgtgatccccagt
aagaagagggtggaaaagaaagaaagagctcgattgaaaactgtgaagttccatgccagg
acggggatgattgagtctaacaggtcgatcaaaacgaaacgtaaaaagagtttccgcctc
tctcgaaagtttccattttacaagagcaaagaaaacatggcccaggagagcagcatacag
gaacagggagtgacatccaacaccagtgacagcgaaagcagttccaaaggacaagaggat
gctattttgtcatatgagccagtgacacggcaagaaattcactatgcaaggcctgtgatc
atcctgggcccaatgaaggaccgagtcaatgatgacctgatctccgaatttccacataaa
tttggatcctgtgtgccacatactacccggcctcgacgtgataatgaggtggatggacaa
gactaccactttgtggtgtcccgagaacaaatggagaaagatattcaggacaacaagttc
atcgaggcgggccaatttaatgataacctctatgggaccagcatccagtcagtgcgggca
gttgcagagaggggcaagcactgcatcttagatgtttccggcaatgctatcaagagactg
cagcaagcacaactttaccccattgccattttcatcaagcccaagtccattgaagccctt
atggaaatgaaccgaaggcagacatatgaacaagcaaataagatctatgacaaagccatg
aaactggagcaggaatttggagagtactttacagccattgtacagggtgactcactggaa
gagatttataacaaaatcaaacaaatcattgaggaccagtctgggcactacatttgggtc
ccatcccctgaaaaactctga

DBGET integrated database retrieval system