KEGG   Homo sapiens (human): 1742Help
Entry
1742              CDS       T01001                                 

Gene name
DLG4, PSD95, SAP-90, SAP90
Definition
discs, large homolog 4 (Drosophila)
Orthology
K11828  
discs large protein 4
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Glutamatergic synapse
Huntington's disease
Cocaine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1742 (DLG4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    1742 (DLG4)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1742 (DLG4)
  Substance dependence
   05030 Cocaine addiction
    1742 (DLG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 721 aa AA seqDB search
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYVNGTEGEMEY
EEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEV
DVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHI
PGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKV
AKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLG
EEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVN
GVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASL
RSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETD
DIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPT
KDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQ
YNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINK
RITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARER
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggactgtctctgtatagtgacaaccaagaaataccgctaccaagatgaagacacgccc
cctctggagcacagcccggcccacctccccaaccaggccaattctcccccagtgattgtc
aacacagataccctagaagccccaggatatgtgaacgggaccgagggggagatggaatac
gaggaaatcacattggaaaggggtaactcaggtctgggcttcagcatcgcaggtggcact
gacaacccacacatcggtgacgacccatccattttcatcaccaagatcattcctggtggg
gctgcggcccaggatggccgcctcagggtcaacgacagcatcctgtttgtaaatgaagtg
gacgtgcgcgaggtgacccactcagcggcggtggaagccctcaaagaggcaggctccatc
gttcgcctctatgtcatgcgccggaagcccccggctgagaaggtcatggagatcaagctc
atcaaggggcctaaaggtcttggcttcagcatcgcagggggcgtagggaaccagcacatc
ccaggagataatagcatctatgtaacaaagatcatcgaagggggtgctgcccacaaggat
gggaggttgcagattggagacaagatcctggcggtcaacagtgtggggctagaggacgtc
atgcatgaagatgctgtggcagccctgaagaacacgtatgatgttgtctacctaaaggtg
gccaagcccagcaatgcctacctgagtgacagctatgctcccccagacatcacaacctct
tattcccagcacctggacaatgagatcagtcacagcagctacctgggcaccgactacccc
acagccatgacccccacttcccctcggcgctactctccagtggccaaggacctgctcggg
gaggaagacattccccgagaaccgaggcgaattgtgatccaccggggctccacgggcctg
ggcttcaacatcgtgggtggcgaggacggtgaaggcatcttcatctcctttatcctggcc
gggggccctgcagacctcagtggggagctgcggaagggggaccagatcctgtcggtcaac
ggtgtggacctccgaaatgccagccatgagcaggctgccattgccctgaagaatgcgggt
cagacggtcacgatcatcgctcagtataaaccagaagagtacagccgattcgaggccaag
atccacgaccttcgggaacagctcatgaacagcagcctgggctcagggactgcgtccctg
cggagcaaccccaaaaggggtttctacatcagggccctgtttgattacgacaagaccaag
gactgcggcttcctgagccaggccctgagcttccgctttggggatgtgctgcatgtcatc
gatgctagtgatgaggagtggtggcaggcacggcgggtccactctgacagtgagaccgac
gacattgggttcatccccagcaaacggcgggttgagcgacgagagtggtcaaggttaaag
gccaaggactggggctccagctctggatcgcagggtcgagaagactcggttctgagctac
gagacagtgacgcagatggaagtgcactatgctcgccccatcatcatccttgggcccacc
aaggaccgcgccaacgatgatcttctctccgagttccccgacaagtttggatcctgtgtt
ccccatacgacacggcccaagcgggagtatgagatagatggccgggattaccactttgtg
tcgtcccgggagaaaatggagaaggacattcaggcgcacaagttcattgaggccggccag
tacaacagccacctctatgggaccagcgtccagtccgtgcgagaggtggcagagcagggg
aagcactgcatcctcgatgtctcggccaatgccgtgcggcggctgcaggcggcccacctg
caccccatcgccatcttcatccgcccccgctccctggagaatgtgctagagattaacaag
cggatcacagaggagcaagcccgcaaagccttcgacagagccaccaagctggagcaggag
ttcacagagtgcttctcagccatcgtggagggtgacagctttgaggagatctaccacaag
gtgaagcgtgtcatcgaggacctctcaggcccctacatctgggttccagcccgagagaga
ctctga

DBGET integrated database retrieval system