KEGG   Homo sapiens (human): 1742Help
Entry
1742              CDS       T01001                                 

Gene name
DLG4, PSD95, SAP-90, SAP90
Definition
(RefSeq) discs large MAGUK scaffold protein 4
  KO
K11828  discs large protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04724  Glutamatergic synapse
hsa05016  Huntington's disease
hsa05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    1742 (DLG4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    1742 (DLG4)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1742 (DLG4)
  Substance dependence
   05030 Cocaine addiction
    1742 (DLG4)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    1742 (DLG4)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    1742 (DLG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_2 MAGUK_N_PEST SH3_1 SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 1742
NCBI-ProteinID: NP_001308004
OMIM: 602887
HGNC: 2903
Ensembl: ENSG00000132535
Vega: OTTHUMG00000134327
Pharos: P78352(Tchem)
UniProt: P78352
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 724 aa AA seqDB search
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGE
MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV
NEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGN
QHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVY
LKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD
LLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL
SVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDS
ETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIIL
GPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE
AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLE
INKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPA
RERL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggactgtctctgtatagtgacaaccaagaaataccgctaccaagatgaagacacgccc
cctctggagcacagcccggcccacctccccaaccaggccaattctcccccagtgattgtc
aacacagataccctagaagccccaggatatgagttgcaggtgaacgggaccgagggggag
atggaatacgaggaaatcacattggaaaggggtaactcaggtctgggcttcagcatcgca
ggtggcactgacaacccacacatcggtgacgacccatccattttcatcaccaagatcatt
cctggtggggctgcggcccaggatggccgcctcagggtcaacgacagcatcctgtttgta
aatgaagtggacgtgcgcgaggtgacccactcagcggcggtggaagccctcaaagaggca
ggctccatcgttcgcctctatgtcatgcgccggaagcccccggctgagaaggtcatggag
atcaagctcatcaaggggcctaaaggtcttggcttcagcatcgcagggggcgtagggaac
cagcacatcccaggagataatagcatctatgtaacaaagatcatcgaagggggtgctgcc
cacaaggatgggaggttgcagattggagacaagatcctggcggtcaacagtgtggggcta
gaggacgtcatgcatgaagatgctgtggcagccctgaagaacacgtatgatgttgtctac
ctaaaggtggccaagcccagcaatgcctacctgagtgacagctatgctcccccagacatc
acaacctcttattcccagcacctggacaatgagatcagtcacagcagctacctgggcacc
gactaccccacagccatgacccccacttcccctcggcgctactctccagtggccaaggac
ctgctcggggaggaagacattccccgagaaccgaggcgaattgtgatccaccggggctcc
acgggcctgggcttcaacatcgtgggtggcgaggacggtgaaggcatcttcatctccttt
atcctggccgggggccctgcagacctcagtggggagctgcggaagggggaccagatcctg
tcggtcaacggtgtggacctccgaaatgccagccatgagcaggctgccattgccctgaag
aatgcgggtcagacggtcacgatcatcgctcagtataaaccagaagagtacagccgattc
gaggccaagatccacgaccttcgggaacagctcatgaacagcagcctgggctcagggact
gcgtccctgcggagcaaccccaaaaggggtttctacatcagggccctgtttgattacgac
aagaccaaggactgcggcttcctgagccaggccctgagcttccgctttggggatgtgctg
catgtcatcgatgctagtgatgaggagtggtggcaggcacggcgggtccactctgacagt
gagaccgacgacattgggttcatccccagcaaacggcgggttgagcgacgagagtggtca
aggttaaaggccaaggactggggctccagctctggatcgcagggtcgagaagactcggtt
ctgagctacgagacagtgacgcagatggaagtgcactatgctcgccccatcatcatcctt
gggcccaccaaggaccgcgccaacgatgatcttctctccgagttccccgacaagtttgga
tcctgtgttccccatacgacacggcccaagcgggagtatgagatagatggccgggattac
cactttgtgtcgtcccgggagaaaatggagaaggacattcaggcgcacaagttcattgag
gccggccagtacaacagccacctctatgggaccagcgtccagtccgtgcgagaggtggca
gagcaggggaagcactgcatcctcgatgtctcggccaatgccgtgcggcggctgcaggcg
gcccacctgcaccccatcgccatcttcatccgcccccgctccctggagaatgtgctagag
attaacaagcggatcacagaggagcaagcccgcaaagccttcgacagagccaccaagctg
gagcaggagttcacagagtgcttctcagccatcgtggagggtgacagctttgaggagatc
taccacaaggtgaagcgtgtcatcgaggacctctcaggcccctacatctgggttccagcc
cgagagagactctga

DBGET integrated database retrieval system