KEGG   Homo sapiens (human): 1743Help
Entry
1743              CDS       T01001                                 

Gene name
DLST, DLTS
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    1743 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    1743 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    1743 (DLST)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     1743 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 166 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFF
RTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPAN
GVIEALLVPDGGKVEGGTPLFTLRKTGGKEVLLVVKVSSVPSWDWD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgatcccgctgtgtgtctcgggcgttcagccgctcgctctccgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgccagggacca
ggttaccctaacagcaggaaggttgtcattaacaacagtgtcttcagtgttcgctttttc
agaactacagctgtatgcaaggatgacttggttacagtcaaaaccccagcgtttgcagaa
tctgtcacagagggagatgtcaggtgggagaaagctgttggagacacagttgcagaagat
gaagtggtttgtgagattgaaactgacaagacatctgtgcaggttccatcaccagcaaat
ggcgtgattgaagctcttttggtacctgatgggggaaaagtcgaaggaggcactccactt
ttcacactcaggaaaactggtggtaaagaagttctcctggtggtcaaggtctccagtgtt
ccctcttgggattgggactga

DBGET integrated database retrieval system