KEGG   Homo sapiens (human): 175Help
Entry
175               CDS       T01001                                 

Gene name
AGA, AGU, ASRG, GA
Definition
aspartylglucosaminidase (EC:3.5.1.26)
Orthology
K01444  
N4-(beta-N-acetylglucosaminyl)-L-asparaginase [EC:3.5.1.26]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Lysosome
Disease
H00145  
Aspartylglucosaminuria (AGU)
H00422  
Glycoproteinoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    175 (AGA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    175 (AGA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.26  N4-(beta-N-acetylglucosaminyl)-L-asparaginase
     175 (AGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q34.3
AA seq 346 aa AA seqDB search
MARKSNLPVLLVPFLLCQALVRCSSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESG
CAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLE
HTTHTLLVGESATTFAQSMGFINEDLSTTASQALHSDWLARNCQPNYWRNVIPDPSKYCG
PYKPPGILKQDIPIHKETEDDRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPI
PGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEF
FGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggaagtcgaacttgcctgtgcttctcgtgccgtttctgctctgccaggcccta
gtgcgctgctccagccctctgcccctggtcgtcaacacttggccctttaagaatgcaacc
gaagcagcgtggagggcattagcatctggaggctctgccctggatgcagtggagagcggc
tgtgccatgtgtgagagagagcagtgtgacggctctgtaggctttggaggaagtcctgat
gaacttggagaaaccacactagatgccatgatcatggatggcactactatggatgtagga
gcagtaggagatctcagacgaattaaaaatgctattggtgtggcacggaaagtactggaa
catacaacacacacacttttagtaggagagtcagccaccacatttgctcaaagtatgggg
tttatcaatgaagacttatctaccactgcttctcaagctcttcattcagattggcttgct
cggaattgccagccaaattattggaggaatgttataccagatccctcaaaatactgcgga
ccctacaaaccacctggtatcttaaagcaggatattcctatccataaagaaacagaagat
gatcgtggtcatgacactattggcatggttgtaatccataagacaggacatattgctgct
ggtacatctacaaatggtataaaattcaaaatacatggccgtgtaggagactcaccaata
cctggagctggagcctatgctgacgatactgcaggggcagccgcagccactgggaatggt
gatatattgatgcgcttcctgccaagctaccaagctgtagaatacatgagaagaggagaa
gatccaaccatagcttgccaaaaagtgatttcaagaatccagaagcattttccagaattc
tttggggctgttatatgtgccaatgtgactggaagttacggtgctgcttgcaataaactt
tcaacatttactcagtttagtttcatggtttataattccgaaaaaaatcagccaactgag
gaaaaagtggactgcatctaa

DBGET integrated database retrieval system