KEGG   Homo sapiens (human): 1759Help
Entry
1759              CDS       T01001                                 

Gene name
DNM1, DNM
Definition
dynamin 1 (EC:3.6.5.5)
Orthology
K01528  
dynamin GTPase [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1759 (DNM1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1759 (DNM1)
  Nervous system
   04721 Synaptic vesicle cycle
    1759 (DNM1)
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1759 (DNM1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     1759 (DNM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1759 (DNM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34
AA seq 851 aa AA seqDB search
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPRITISDP
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgcggcatggaagatctcatcccgctggtcaaccggctgcaagacgccttc
tctgccatcggccagaacgcggacctcgacctgccgcagatcgctgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaatttcgtaggcagggacttcttgcctcgagga
tctggcattgtcacccgacgtcccctggtcttgcagctggtcaatgcaaccacagaatat
gccgagttcctgcactgcaagggaaagaaattcaccgacttcgaggaggtgcgccttgag
atcgaggccgagaccgacagggtcaccggcaccaacaagggcatctcgccggtgcctatc
aacctccgcgtctactcgccgcacgtgctgaacctgaccctggtggacctgcccggaatg
accaaggtcccggtgggggaccaacctcccgacatcgagttccagatccgagacatgctt
atgcagtttgtcaccaaggagaactgcctcatcctggccgtgtcccccgccaactctgac
ctggccaattctgacgccctcaaggtcgccaaggaggtggacccccagggccagcgcacc
atcggggtcatcaccaagctggacctgatggacgagggcacagatgcccgtgatgtgctg
gagaacaagctgctccccctgcgcagaggctacattggagtggtgaaccggagccagaag
gacattgatggcaagaaggacattaccgccgccttggctgctgaacgaaagttcttcctc
tcccatccatcttatcgccacttggctgaccgtatgggcacgccctacctgcagaaggtc
ctcaatcagcaactgacgaaccacatccgggacacactgccggggctgcggaacaagctg
cagagccagctactgtccattgagaaggaggtggaggaatacaagaacttccgccctgat
gacccagctcgcaagaccaaggccctgctgcagatggtccagcagttcgccgtagacttt
gagaagcgcattgagggctcaggagatcagatcgacacctacgaactgtcagggggagcc
cgcattaaccgaatcttccacgagcgcttccctttcgagctggtcaagatggagtttgat
gagaaggaactccgaagggagatcagctatgctatcaagaatatccatggcattagaacg
gggctgtttaccccagacatggcctttgagaccattgtgaaaaagcaggtgaagaagatc
cgagaaccgtgtctcaagtgtgtggacatggttatctcggagctaatcagcaccgttaga
cagtgcaccaagaagctccagcagtacccgcggctacgggaggagatggagcgcatcgtg
accacccacatccgggagcgcgagggccgcactaaggagcaggtcatgcttctcatcgat
atcgagctggcttacatgaacaccaaccatgaggacttcataggctttgccaatgctcag
cagaggagcaaccagatgaacaagaagaagacttcagggaaccaggatgagattctggtc
atccgcaagggctggctgactatcaataatattggcatcatgaaagggggctccaaggag
tactggtttgtgctgactgctgagaatctgtcctggtacaaggatgatgaggagaaagag
aagaaatacatgctgtctgtggacaacctcaagctgcgggacgtggagaagggctttatg
tcgagcaagcatatctttgccctctttaacacggagcagaggaatgtctacaaggattat
cggcagctggagctagcctgtgagacacaggaggaggtggacagctggaaggcctccttc
ctgagggctggcgtgtaccctgagcgtgttggggacaaagagaaagccagcgagaccgag
gagaatggctccgacagcttcatgcattccatggacccacagctggaacggcaagtggag
accatccggaatcttgtggactcatacatggccattgtcaacaagaccgtgagggacctc
atgcccaagaccatcatgcacctcatgattaacaataccaaggagttcatcttctcggag
ctgctggccaacctgtactcgtgtggggaccagaacacgctgatggaggagtcggcggag
caggcacagcggcgcgacgagatgctgcgcatgtaccacgcactgaaggaggcgctcagc
atcatcggcgacatcaacacgaccaccgtcagcacgcccatgcccccgcccgtggacgac
tcctggctgcaggtgcagagcgtaccggccggacgcaggtcgcccacgtccagccccacg
ccgcagcgccgagcccccgccgtgcccccagcccggcccgggtcgcggggccctgctcct
gggcctccgcctgctgggtccgccctggggggggcgccccccgtgccctccaggccgggg
gcttcccctgaccctttcggccctccccctcaggtgccctcgcgccccaaccgcgccccg
cccggggtccccagaatcactatcagtgacccctga

DBGET integrated database retrieval system