KEGG   Homo sapiens (human): 178Help
Entry
178               CDS       T01001                                 

Gene name
AGL, GDE
Definition
(RefSeq) amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
  KO
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Disease
H00069  
Glycogen storage diseases (GSD)
H01760  
Hepatic glycogen storage disease
H01762  
Muscle glycogen storage disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    178 (AGL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     178 (AGL)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     178 (AGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P35573(Tbio)
UniProt: 
Position
1p21.2
AA seq 1532 aa AA seqDB search
MGHSKQIRILLLNEMEKLEKTLFRLEQGYELQFRLGPTLQGKAVTVYTNYPFPGETFNRE
KFRSLDWENPTEREDDSDKYCKLNLQQSGSFQYYFLQGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLE
LNPDFSRPNRKYTWNDVGQLVEKLKKEWNVICITDVVYNHTAANSKWIQEHPECAYNLVN
SPHLKPAWVLDRALWRFSCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWE
FFQVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDMNIALTTFIPH
DKGPAAIEECCNWFHKRMEELNSEKHRLINYHQEQAVNCLLGNVFYERLAGHGPKLGPVT
RKHPLVTRYFTFPFEEIDFSMEESMIHLPNKACFLMAHNGWVMGDDPLRNFAEPGSEVYL
RRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYML
DAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGEP
VGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSMACCASGSTRGY
DELVPHQISVVSEERFYTKWNPEALPSNTGEVNFQSGIIAARCAISKLHQELGAKGFIQV
YVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEAR
TIERNTKPYRKDENSINGTPDITVEIREHIQLNESKIVKQAGVATKGPNEYIQEIEFENL
SPGSVIIFRVSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPILKIPFASLASRLT
LAELNQILYRCESEEKEDGGGCYDIPNWSALKYAGLQGLMSVLAEIRPKNDLGHPFCNNL
RSGDWMIDYVSNRLISRSGTIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGAYTTLLD
TAWKQMSSFVQNGSTFVKHLSLGSVQLCGVGKFPSLPILSPALMDVPYRLNEITKEKEQC
CVSLAAGLPHFSSGIFRCWGRDTFIALRGILLITGRYVEARNIILAFAGTLRHGLIPNLL
GEGIYARYNCRDAVWWWLQCIQDYCKMVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQPL
FEVIQEAMQKHMQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGFVYGGNRFNCGTWM
DKMGESDRARNRGIPATPRDGSAVEIVGLSKSAVRWLLELSKKNIFPYHEVTVKRHGKAI
KVSYDEWNRKIQDNFEKLFHVSEDPSDLNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPN
FTIAMVVAPELFTTEKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGIYDNALDNDNYNLA
KGFNYHQGPEWLWPIGYFLRAKLYFSRLMGPETTAKTIVLVKNVLSRHYVHLERSPWKGL
PELTNENAQYCPFSCETQAWSIATILETLYDL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atgggacacagtaaacagattcgaattttacttctgaacgaaatggagaaactggaaaag
accctcttcagacttgaacaagggtatgagctacagttccgattaggcccaactttacag
ggaaaagcagttaccgtgtatacaaattacccatttcctggagaaacatttaatagagaa
aaattccgttctctggattgggaaaatccaacagaaagagaagatgattctgataaatac
tgtaaacttaatctgcaacaatctggttcatttcagtattatttccttcaaggaaatgag
aaaagtggtggaggttacatagttgtggaccccattttacgtgttggtgctgataatcat
gtgctacccttggactgtgttactcttcagacatttttagctaagtgtttgggacctttt
gatgaatgggaaagcagacttagggttgcaaaagaatcaggctacaacatgattcatttt
accccattgcagactcttggactatctaggtcatgctactcccttgccaatcagttagaa
ttaaatcctgacttttcaagacctaatagaaagtatacctggaatgatgttggacagcta
gtggaaaaattaaaaaaggaatggaatgttatttgtattactgatgttgtctacaatcat
actgctgctaatagtaaatggatccaggaacatccagaatgtgcctataatcttgtgaat
tctccacacttaaaacctgcctgggtcttagacagagcactttggcgtttctcctgtgat
gttgcagaagggaaatacaaagaaaagggaatacctgctttgattgaaaatgatcaccat
atgaattccatccgaaaaataatttgggaggatatttttccaaagcttaaactctgggaa
tttttccaagtagatgtcaacaaagcggttgagcaatttagaagacttcttacacaagaa
aataggcgagtaaccaagtctgatccaaaccaacaccttacgattattcaagatcctgaa
tacagacggtttggctgtactgtagatatgaacattgcactaacgactttcataccacat
gacaaggggccagcagcaattgaagaatgctgtaattggtttcataaaagaatggaggaa
ttaaattcagagaagcatcgactcattaactatcatcaggaacaggcagttaattgcctt
ttgggaaatgtgttttatgaacgactggctggccatggtccaaaactaggacctgtcact
agaaagcatcctttagttaccaggtattttactttcccatttgaagagatagacttctcc
atggaagaatctatgattcatctgccaaataaagcttgttttctgatggcacacaatgga
tgggtaatgggagatgatcctcttcgaaactttgctgaaccgggttcagaagtttaccta
aggagagaacttatttgctggggagacagtgttaaattacgctatgggaataaaccagag
gactgtccttatctctgggcacacatgaaaaaatacactgaaataactgcaacttatttc
cagggagtacgtcttgataactgccactcaacacctcttcacgtagctgagtacatgttg
gatgctgctaggaatttgcaacccaatttatatgtagtagctgaactgttcacaggaagt
gaagatctggacaatgtctttgttactagactgggcattagttccttaataagagaggca
atgagtgcatataatagtcatgaagagggcagattagtttaccgatatggaggagaacct
gttggatcctttgttcagccctgtttgaggcctttaatgccagctattgcacatgccctg
tttatggatattacgcatgataatgagtgtcctattgtgcatagatcagcgtatgatgct
cttccaagtactacaattgtttctatggcatgttgtgctagtggaagtacaagaggctat
gatgaattagtgcctcatcagatttcagtggtttctgaagaacggttttacactaagtgg
aatcctgaagcattgccttcaaacacaggtgaagttaatttccaaagcggcattattgca
gccaggtgtgctatcagtaaacttcatcaggagcttggagccaagggttttattcaggtg
tatgtggatcaagttgatgaagacatagtggcagtaacaagacactcacctagcatccat
cagtctgttgtggctgtatctagaactgctttcaggaatcccaagacttcattttacagc
aaggaagtgcctcaaatgtgcatccctggcaaaattgaagaagtagttcttgaagctaga
actattgagagaaacacgaaaccttataggaaggatgagaattcaatcaatggaacacca
gatatcacagtagaaattagagaacatattcagcttaatgaaagtaaaattgttaaacaa
gctggagttgccacaaaagggcccaatgaatatattcaagaaatagaatttgaaaacttg
tctccaggaagtgttattatattcagagttagtcttgatccacatgcacaagtcgctgtt
ggaattcttcgaaatcatctgacacaattcagtcctcactttaaatctggcagcctagct
gttgacaatgcagatcctatattaaaaattccttttgcttctcttgcctccagattaact
ttggctgagctaaatcagatcctttaccgatgtgaatcagaagaaaaggaagatggtgga
gggtgctatgacataccaaactggtcagcccttaaatatgcaggtcttcaaggtttaatg
tctgtattggcagaaataagaccaaagaatgacttggggcatcctttttgtaataatttg
agatctggagattggatgattgactatgtcagtaaccggcttatttcacgatcaggaact
attgctgaagttggtaaatggttgcaggctatgttcttctacctgaagcagatcccacgt
taccttatcccatgttactttgatgctatattaattggtgcatataccactcttctggat
acagcatggaagcagatgtcaagctttgttcagaatggttcaacctttgtgaaacacctt
tcattgggttcagttcaactgtgtggagtaggaaaattcccttccctgccaattctttca
cctgccctaatggatgtaccttataggttaaatgagatcacaaaagaaaaggagcaatgt
tgtgtttctctagctgcaggcttacctcatttttcttctggtattttccgctgctgggga
agggatacttttattgcacttagaggtatactgctgattactggacgctatgtagaagcc
aggaatattattttagcatttgcgggtaccctgaggcatggtctcattcctaatctactg
ggtgaaggaatttatgccagatacaattgtcgggatgctgtgtggtggtggctgcagtgt
atccaggattactgtaaaatggttccaaatggtctagacattctcaagtgcccagtttcc
agaatgtatcctacagatgattctgctcctttgcctgctggcacactggatcagccattg
tttgaagtcatacaggaagcaatgcaaaaacacatgcagggcatacagttccgagaaagg
aatgctggtccccagatagatcgaaacatgaaggacgaaggttttaatataactgcagga
gttgatgaagaaacaggatttgtttatggaggaaatcgtttcaattgtggcacatggatg
gataaaatgggagaaagtgacagagctagaaacagaggaatcccagccacaccaagagat
gggtctgctgtggaaattgtgggcctgagtaaatctgctgttcgctggttgctggaatta
tccaaaaaaaatattttcccttatcatgaagtcacagtaaaaagacatggaaaggctata
aaggtctcatatgatgagtggaacagaaaaatacaagacaactttgaaaagctatttcat
gtttccgaagacccttcagatttaaatgaaaagcatccaaatctggttcacaaacgtggc
atatacaaagatagttatggagcttcaagtccttggtgtgactatcagctcaggcctaat
tttaccatagcaatggttgtggcccctgagctctttactacagaaaaagcatggaaagct
ttggagattgcagaaaaaaaattgcttggtccccttggcatgaaaactttagatccagat
gatatggtttactgtggaatttatgacaatgcattagacaatgacaactacaatcttgct
aaaggtttcaattatcaccaaggacctgagtggctgtggcctattgggtattttcttcgt
gcaaaattatatttttccagattgatgggcccggagactactgcaaagactatagttttg
gttaaaaatgttctttcccgacattatgttcatcttgagagatccccttggaaaggactt
ccagaactgaccaatgagaatgcccagtactgtcctttcagctgtgaaacacaagcctgg
tcaattgctactattcttgagacactttatgatttatag

DBGET integrated database retrieval system