KEGG   Homo sapiens (human): 1780Help
Entry
1780              CDS       T01001                                 

Gene name
DYNC1I1, DNCI1, DNCIC1
Definition
(RefSeq) dynein cytoplasmic 1 intermediate chain 1
  KO
K10415  
dynein intermediate chain, cytosolic
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Vasopressin-regulated water reabsorption
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1780 (DYNC1I1)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    1780 (DYNC1I1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    1780 (DYNC1I1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      1780 (DYNC1I1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     1780 (DYNC1I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.3
AA seq 645 aa AA seqDB search
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPL
TRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
EDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRV
IERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGT
YSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVF
EGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMW
SPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaagtgacttaaaagctgagctagagcgcaaaaagcagcgcttagcacag
ataagagaagagaagaaacggaaggaagaggagaggaaaaagaaagaggctgatatgcag
cagaagaaagaacccgttcaggacgactctgatctggatcgcaaacgacgagagacagag
gctttgctgcaaagcattggtatctcaccggagccgcctctagtgcagccgctgcatttt
ttaacatgggatacctgttattttcattatttagtcccaacccctatgtctccctcctcg
aaatcagtgagcactcccagtgaagctggaagccaagactcaggcgatctggggccatta
acaaggaccctgcagtgggacacagacccctcagtgctccagctgcagtcagactcagaa
cttggaagaagactgcataaactgggcgtgtcaaaggtcacccaagtggatttcctgcca
agggaagtagtgtcctactcaaaggagacccagactcctcttgccacgcatcagtctgaa
gaggatgaggaagatgaggaaatggtggaatctaaagttggccaggactcagaactggaa
aatcaggacaaaaaacaggaagtgaaggaagcccctccaagagagttgacagaggaagaa
aaacagcagatccttcattcagaggaatttctcatcttttttgaccggacaatacgggta
attgaaagagccctggctgaagattccgacatcttttttgactacagcggccgagagtta
gaggaaaaagatggggatgttcaggctggagccaatctttctttcaatcgtcagttctat
gatgaacattggtccaagcatcgagtggtcacttgtatggactggtccctccagtaccct
gagctgatggtggcttcttacaacaacaatgaagatgctccccatgaaccagatggagtg
gccttggtttggaacatgaagtttaagaaaaccacaccagaatacgtcttccactgtcag
tcctctgtgatgtcggtctgcttcgcccgtttccatcctaacttggtggttggtgggact
tactcgggccagattgtcctctgggacaatcgcagtcatcgaaggactccagtgcagcgg
acacccttatcagctgctgcacacacgcatcccgtgtactgtgtaaatgttgttgggacc
cagaatgctcataacctcatcactgtctccactgatggcaaaatgtgttcctggagcctg
gacatgctctcaactccacaggagagcatggagctggtgtacaataagtccaagcctgtc
gctgttaccggaatggctttcccaacgggagacgtcaataacttcgtggttggcagtgag
gaaggtacagtctacacggcttgtcgtcatggaagcaaagcaggtattggtgaggtcttt
gaaggtcaccaagggccagtgacaggaattaactgccacatggcagtgggcccaatcgac
ttttctcacctgtttgtcacatcatcatttgactggactgtcaaactgtggaccaccaag
cacaacaagccgctctactcctttgaagacaatgcagactatgtgtacgatgtcatgtgg
tcccccgtgcatcctgcgctttttgcctgcgtggacgggatggggcgcttggacctctgg
aacctcaacaatgacaccgaggttccaacagcaagtgtggccattgagggggcatccgcc
ctaaaccgtgttcgttgggcccaagctggcaaagaagttgctgttggggactcggaaggc
cgtatttgggtctatgacgttggagagcttgcagttccccacaatgatgaatggacccga
tttgccaggacccttgtggaaattcgtgctaacagagctgatagcgaggaggaaggcact
gttgagttatctgcctag

DBGET integrated database retrieval system