KEGG   Homo sapiens (human): 1783Help
Entry
1783              CDS       T01001                                 

Gene name
DYNC1LI2, DNCLI2, LIC2
Definition
dynein, cytoplasmic 1, light intermediate chain 2
Orthology
K10416  
dynein light intermediate chain 1, cytosolic
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Vasopressin-regulated water reabsorption
Salmonella infection
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 415 aa AA seqDB search
MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVF
GEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDVVKDFQDYMEPEEGCQGSPQR
RGPLTSGSDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVLEKEHDYRDEHLDFIQSH
LRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPALVVEKDAVFIPAGWDNE
KKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQVFLMKQQSLLAKQPATP
TRASESPARGPSGSPRTQGRGGPASVPSSSPGTSVKKPDPNIKNNAASEGVLASFFNSLL
SKKTGSPGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTENEA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgggggtggagaagaagctgctgctaggtcccaacgggcccgcggtggcg
gccgccggcgacctgaccagtgaggaggaggaaggccagagcctatggtcctccattctg
agcgaagtgtccacccgcgccaggtccaagctgccgtccggcaagaacatcctggtcttc
ggtgaagatggttctggtaaaacaaccctcatgactaaactacaaggagctgagcatggc
aaaaaaggaagaggcctagaatatctctacctcagtgtccatgatgaggaccgagatgtt
gtgaaagattttcaagactatatggaacctgaagaaggttgtcaaggttccccacagaga
agaggccctctgacctcaggctccgatgaagaaaatgttgccctgcctctgggtgacaat
gtgctgactcataacctggggatcccggtgttggtggtgtgcacaaagtgtgatgcggtg
agtgtcctggagaaggagcacgattacagggatgagcatttggactttatccagtcacac
ctgcggaggttctgccttcagtatggagctgccttgatttacacatcagtgaaagaagag
aaaaacctcgacttgttgtataagtatattgttcataaaacatacggtttccacttcacc
acacctgccttagttgtggaaaaggatgccgtttttatacctgcaggctgggacaatgaa
aagaaaatagctattttacatgaaaattttacaaccgtgaagccggaagatgcatatgaa
gactttattgtgaaacctcccgtgagaaagctggtccacgacaaagagttggcagcagaa
gatgagcaggtgttcctaatgaagcaacagtcactccttgccaagcaaccagccactccc
acgagagcttctgaatctcctgcaagaggaccctctggctctccaaggacccagggtcgg
ggagggccagccagtgtgcctagctcctccccaggcacgtcagtaaaaaagccggaccca
aacatcaaaaataatgcagcaagtgaaggggtgttggccagcttcttcaacagtctgttg
agtaaaaagacaggctctcctggaagtcctggtgctggtggggtgcagagcacagccaag
aagtcaggacaaaagactgtgttgtcaaatgttcaggaagaactggatagaatgactcga
aagccagactctatggtaacaaactcttcaacagaaaatgaagcctga

DBGET integrated database retrieval system