KEGG   Homo sapiens (human): 1785Help
Entry
1785              CDS       T01001                                 

Gene name
DNM2, CMT2M, CMTDI1, CMTDIB, DI-CMTB, DYN2, DYNII, LCCS5
Definition
(RefSeq) dynamin 2
  KO
K01528  dynamin GTPase [EC:3.6.5.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05100  Bacterial invasion of epithelial cells
Disease
H00264  Charcot-Marie-Tooth disease (CMT)
H00700  Centronuclear myopathy
H00865  Lethal congenital contractural syndrome (LCCS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    1785 (DNM2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1785 (DNM2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    1785 (DNM2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1785 (DNM2)
  Nervous system
   04721 Synaptic vesicle cycle
    1785 (DNM2)
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    1785 (DNM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     1785 (DNM2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    1785 (DNM2)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    1785 (DNM2)
   RhoA-dependent endocytosis
    1785 (DNM2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1785 (DNM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 AAA_28 PH_11
Motif
Other DBs
NCBI-GeneID: 1785
NCBI-ProteinID: NP_001005360
OMIM: 602378
HGNC: 2974
Ensembl: ENSG00000079805
Vega: OTTHUMG00000180694
Pharos: P50570(Tchem)
UniProt: P50570
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 870 aa AA seqDB search
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL
QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGA
RINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKL
KEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLID
IEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKE
YWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL
RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLV
DSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRD
DMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGR
PPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPP
GIPPGVPSRRPPAAPSRPTIIRPAEPSLLD
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccgcgggatggaagagctgatcccgctggtcaacaaactgcaggacgccttc
agctccatcggccagagctgccacctggacctgccgcagatcgctgtagtgggcggccag
agcgccggcaagagctcggtgctggagaacttcgtgggccgggacttccttccccgcggt
tcaggaatcgtcacccggcggcctctcattctgcagctcatcttctcaaaaacagaacat
gccgagtttttgcactgcaagtccaaaaagtttacagactttgatgaagtccggcaggag
attgaagcagagaccgacagggtcacggggaccaacaaaggcatctccccagtgcccatc
aaccttcgagtctactcgccacacgtgttgaacttgaccctcatcgacctcccgggtatc
accaaggtgcctgtgggcgaccagcctccagacatcgagtaccagatcaaggacatgatc
ctgcagttcatcagccgggagagcagcctcattctggctgtcacgcccgccaacatggac
ctggccaactccgacgccctcaagctggccaaggaagtcgatccccaaggcctacggacc
atcggtgtcatcaccaagcttgacctgatggacgagggcaccgacgccagggacgtcttg
gagaacaagttgctcccgttgagaagaggctacattggcgtggtgaaccgcagccagaag
gatattgagggcaagaaggacatccgtgcagcactggcagctgagaggaagttcttcctc
tcccacccggcctaccggcacatggccgaccgcatgggcacgccacatctgcagaagacg
ctgaatcagcaactgaccaaccacatccgggagtcgctgccggccctacgtagcaaacta
cagagccagctgctgtccctggagaaggaggtggaggagtacaagaactttcggcccgac
gaccccacccgcaaaaccaaagccctgctgcagatggtccagcagtttggggtggatttt
gagaagaggatcgagggctcaggagatcaggtggacactctggagctctccgggggcgcc
cgaatcaatcgcatcttccacgagcggttcccatttgagctggtgaagatggagtttgac
gagaaggacttacgacgggagatcagctatgccattaagaacatccatggagtcaggacc
gggcttttcaccccggacttggcattcgaggccattgtgaaaaagcaggtcgtcaagctg
aaagagccctgtctgaaatgtgtcgacctggttatccaggagctaatcaatacagttagg
cagtgtaccagtaagctcagttcctacccccggttgcgagaggagacagagcgaatcgtc
accacttacatccgggaacgggaggggagaacgaaggaccagattcttctgctgatcgac
attgagcagtcctacatcaacacgaaccatgaggacttcatcgggtttgccaatgcccag
cagaggagcacgcagctgaacaagaagagagccatccccaatcagggggagatcctggtg
atccgcaggggctggctgaccatcaacaacatcagcctgatgaaaggcggctccaaggag
tactggtttgtgctgactgccgagtcactgtcctggtacaaggatgaggaggagaaagag
aagaagtacatgctgcctctggacaacctcaagatccgtgatgtggagaagggcttcatg
tccaacaagcacgtcttcgccatcttcaacacggagcagagaaacgtctacaaggacctg
cggcagatcgagctggcctgtgactcccaggaagacgtggacagctggaaggcctcgttc
ctccgagctggcgtctaccccgagaaggaccaggcagaaaacgaggatggggcccaggag
aacaccttctccatggacccccaactggagcggcaggtggagaccattcgcaacctggtg
gactcatacgtggccatcatcaacaagtccatccgcgacctcatgccaaagaccatcatg
cacctcatgatcaacaatacgaaggccttcatccaccacgagctgctggcctacctatac
tcctcggcagaccagagcagcctcatggaggagtcggctgaccaggcacagcggcgggac
gacatgctgcgcatgtaccatgccctcaaggaggcgctcaacatcatcggtgacatcagc
accagcactgtgtccacgcctgtacccccgcctgtcgatgacacctggctccagagcgcc
agcagccacagccccactccacagcgccgaccggtgtccagcatacacccccctggccgg
cccccagcagtgaggggccccactccagggccccccctgattcctgttcccgtgggggca
gcagcctccttctcggcgcccccaatcccatcccggcctggaccccagagcgtgtttgcc
aacagtgacctcttcccagccccgcctcagatcccatctcggccagttcggatcccccca
gggattcccccaggagtgcccagcagaagaccccctgctgcgcccagccggcccaccatt
atccgcccagccgagccatccctgctcgactag

DBGET integrated database retrieval system