KEGG   Homo sapiens (human): 1786Help
Entry
1786              CDS       T01001                                 

Gene name
DNMT1, ADCADN, AIM, CXXC9, DNMT, HSN1E, MCMT, m.HsaI
Definition
(RefSeq) DNA (cytosine-5-)-methyltransferase 1 (EC:2.1.1.37)
  KO
K00558  
DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
MicroRNAs in cancer
Module
Methionine degradation
Drug target
Azacitidine: 
Decitabine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    1786 (DNMT1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    1786 (DNMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     1786 (DNMT1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    1786 (DNMT1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    1786 (DNMT1)
Prokaryotic defense system [BR:hsa02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    1786 (DNMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 1616 aa AA seqDB search
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQ
LCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRV
GMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP
QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEK
EEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPE
EKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYL
DDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLC
PIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFS
TSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGL
NLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQAR
RQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQ
QPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQ
GKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVT
ALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPS
ENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLA
EMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPR
KEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNK
FYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGP
NRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLR
TLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMA
GETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRP
RFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAP
GEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNG
ASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLP
NIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCL
PHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFP
DTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD
NT seq 4851 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgcgtaccgccccagcccgggtgcccacactggccgtcccggccatctcgctg
cccgacgatgtccgcaggcggctcaaagatttggaaagagacagcttaacagaaaaggaa
tgtgtgaaggagaaattgaatctcttgcacgaatttctgcaaacagaaataaagaatcag
ttatgtgacttggaaaccaaattacgtaaagaagaattatccgaggagggctacctggct
aaagtcaaatcccttttaaataaagatttgtccttggagaacggtgctcatgcttacaac
cgggaagtgaatggacgtctagaaaacgggaaccaagcaagaagtgaagcccgtagagtg
ggaatggcagatgccaacagcccccccaaacccctttccaaacctcgcacgcccaggagg
agcaagtccgatggagaggctaagcctgaaccttcacctagccccaggattacaaggaaa
agcaccaggcaaaccaccatcacatctcattttgcaaagggccctgccaaacggaaacct
caggaagagtctgaaagagccaaatcggatgagtccatcaaggaagaagacaaagaccag
gatgagaagagacgtagagttacatccagagaacgagttgctagaccgcttcctgcagaa
gaacctgaaagagcaaaatcaggaacgcgcactgaaaaggaagaagaaagagatgaaaaa
gaagaaaagagactccgaagtcaaaccaaagaaccaacacccaaacagaaactgaaggag
gagccggacagagaagccagggcaggcgtgcaggctgacgaggacgaagatggagacgag
aaagatgagaagaagcacagaagtcaacccaaagatctagctgccaaacggaggcccgaa
gaaaaagaacctgaaaaagtaaatccacagatttctgatgaaaaagacgaggatgaaaag
gaggagaagagacgcaaaacgacccccaaagaaccaacggagaaaaaaatggctcgcgcc
aaaacagtcatgaactccaagacccaccctcccaagtgcattcagtgcgggcagtacctg
gacgaccctgacctcaaatatgggcagcacccaccagacgcggtggatgagccacagatg
ctgacaaatgagaagctgtccatctttgatgccaacgagtctggctttgagagttatgag
gcgcttccccagcacaaactgacctgcttcagtgtgtactgtaagcacggtcacctgtgt
cccatcgacaccggcctcatcgagaagaatatcgaactcttcttttctggttcagcaaaa
ccaatctatgatgatgacccatctcttgaaggtggtgttaatggcaaaaatcttggcccc
ataaatgaatggtggatcactggctttgatggaggtgaaaaggccctcatcggcttcagc
acctcatttgccgaatacattctgatggatcccagtcccgagtatgcgcccatatttggg
ctgatgcaggagaagatctacatcagcaagattgtggtggagttcctgcagagcaattcc
gactcgacctatgaggacctgatcaacaagatcgagaccacggttcctccttctggcctc
aacttgaaccgcttcacagaggactccctcctgcgacacgcgcagtttgtggtggagcag
gtggagagttatgacgaggccggggacagtgatgagcagcccatcttcctgacaccctgc
atgcgggacctgatcaagctggctggggtcacgctgggacagaggcgagcccaggcgagg
cggcagaccatcaggcattctaccagggagaaggacaggggacccacgaaagccaccacc
accaagctggtctaccagatcttcgatactttcttcgcagagcaaattgaaaaggatgac
agagaagacaaggagaacgcctttaagcgccggcgatgtggcgtctgtgaggtgtgtcag
cagcctgagtgtgggaaatgtaaagcctgcaaggacatggttaaatttggtggcagtgga
cggagcaagcaggcttgccaagagcggaggtgtcccaatatggccatgaaggaggcagat
gacgatgaggaagtcgatgataacatcccagagatgccgtcacccaaaaaaatgcaccag
gggaagaagaagaaacagaacaagaatcgcatctcttgggtcggagaagccgtcaagact
gatgggaagaagagttactataagaaggtgtgcattgatgcggaaaccctggaagtgggg
gactgtgtctctgttattccagatgattcctcaaaaccgctgtatctagcaagggtcacg
gcgctgtgggaggacagcagcaacgggcagatgtttcacgcccactggttctgcgctggg
acagacacagtcctcggggccacgtcggaccctctggagctgttcttggtggatgaatgt
gaggacatgcagctttcatatatccacagcaaagtgaaagtcatctacaaagccccctcc
gaaaactgggccatggagggaggcatggatcccgagtccctgctggagggggacgacggg
aagacctacttctaccagctgtggtatgatcaagactacgcgagattcgagtcccctcca
aaaacccagccaacagaggacaacaagttcaaattctgtgtgagctgtgcccgtctggct
gagatgaggcaaaaagaaatccccagggtcctggagcagctcgaggacctggatagccgg
gtcctctactactcagccaccaagaacggcatcctgtaccgagttggtgatggtgtgtac
ctgccccctgaggccttcacgttcaacatcaagctgtccagtcccgtgaaacgcccacgg
aaggagcccgtggatgaggacctgtacccagagcactaccggaaatactccgactacatc
aaaggcagcaacctggatgcccctgagccctaccgaattggccggatcaaagagatcttc
tgtcccaagaagagcaacggcaggcccaatgagactgacatcaaaatccgggtcaacaag
ttctacaggcctgagaacacccacaagtccactccagcgagctaccacgcagacatcaac
ctgctctactggagcgacgaggaggccgtggtggacttcaaggctgtgcagggccgctgc
accgtggagtatggggaggacctgcccgagtgcgtccaggtgtactccatgggcggcccc
aaccgcttctacttcctcgaggcctataatgcaaagagcaaaagctttgaagatcctccc
aaccatgcccgtagccctggaaacaaagggaagggcaagggaaaagggaagggcaagccc
aagtcccaagcctgtgagccgagcgagccagagatagagatcaagctgcccaagctgcgg
accctggatgtgttttctggctgcggggggttgtcggagggattccaccaagcaggcatc
tctgacacgctgtgggccatcgagatgtgggaccctgcggcccaggcgttccggctgaac
aaccccggctccacagtgttcacagaggactgcaacatcctgctgaagctggtcatggct
ggggagaccaccaactcccgcggccagcggctgccccagaagggagacgtggagatgctg
tgcggcgggccgccctgccagggcttcagcggcatgaaccgcttcaattcgcgcacctac
tccaagttcaaaaactctctggtggtttccttcctcagctactgcgactactaccggccc
cggttcttcctcctggagaatgtcaggaactttgtctccttcaagcgctccatggtcctg
aagctcaccctccgctgcctggtccgcatgggctatcagtgcaccttcggcgtgctgcag
gccggtcagtacggcgtggcccagactaggaggcgggccatcatcctggccgcggcccct
ggagagaagctccctctgttcccggagccactgcacgtgtttgctccccgggcctgccag
ctgagcgtggtggtggatgacaagaagtttgtgagcaacataaccaggttgagctcgggt
cctttccggaccatcacggtgcgagacacgatgtccgacctgccggaggtgcggaatgga
gcctcggcactggagatctcctacaacggggagcctcagtcctggttccagaggcagctc
cggggcgcacagtaccagcccatcctcagggaccacatctgtaaggacatgagtgcattg
gtggctgcccgcatgcggcacatccccttggccccagggtcagactggcgcgatctgccc
aacatcgaggtgcggctctcagacggcaccatggccaggaagctgcggtatacccaccat
gacaggaagaacggccgcagcagctctggggccctccgtggggtctgctcctgcgtggaa
gccggcaaagcctgcgaccccgcagccaggcagttcaacaccctcatcccctggtgcctg
ccccacaccgggaaccggcacaaccactgggctggcctctatggaaggctcgagtgggac
ggcttcttcagcacaaccgtcaccaaccccgagcccatgggcaagcagggccgcgtgctc
cacccagagcagcaccgtgtggtgagcgtgcgggagtgtgcccgctcccagggcttccct
gacacctaccggctcttcggcaacatcctggacaagcaccggcaggtgggcaatgccgtg
ccaccgcccctggccaaagccattggcttggagatcaagctttgtatgttggccaaagcc
cgagagagtgcctcagctaaaataaaggaggaggaagctgctaaggactag

DBGET integrated database retrieval system