KEGG   Homo sapiens (human): 1788Help
Entry
1788              CDS       T01001                                 

Gene name
DNMT3A, DNMT3A2, M.HsaIIIA
Definition
DNA (cytosine-5-)-methyltransferase 3 alpha (EC:2.1.1.37)
Orthology
K17398  
DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
MicroRNAs in cancer
Module
Methionine degradation
Drug target
Azacitidine: 
Decitabine: 
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p23
AA seq 912 aa AA seqDB search
MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPV
ESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEG
AAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSL
RQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVE
EASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKL
RGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYN
KQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPK
GLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLV
YEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTIC
CGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRED
WPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRY
IASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPAR
KGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMI
DAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRH
LFAPLKEYFACV
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccatgccctccagcggccccggggacaccagcagctctgctgcggagcgggag
gaggaccgaaaggacggagaggagcaggaggagccgcgtggcaaggaggagcgccaagag
cccagcaccacggcacggaaggtggggcggcctgggaggaagcgcaagcaccccccggtg
gaaagcggtgacacgccaaaggaccctgcggtgatctccaagtccccatccatggcccag
gactcaggcgcctcagagctattacccaatggggacttggagaagcggagtgagccccag
ccagaggaggggagccctgctggggggcagaagggcggggccccagcagagggagagggt
gcagctgagaccctgcctgaagcctcaagagcagtggaaaatggctgctgcacccccaag
gagggccgaggagcccctgcagaagcgggcaaagaacagaaggagaccaacatcgaatcc
atgaaaatggagggctcccggggccggctgcggggtggcttgggctgggagtccagcctc
cgtcagcggcccatgccgaggctcaccttccaggcgggggacccctactacatcagcaag
cgcaagcgggacgagtggctggcacgctggaaaagggaggctgagaagaaagccaaggtc
attgcaggaatgaatgctgtggaagaaaaccaggggcccggggagtctcagaaggtggag
gaggccagccctcctgctgtgcagcagcccactgaccccgcatcccccactgtggctacc
acgcctgagcccgtggggtccgatgctggggacaagaatgccaccaaagcaggcgatgac
gagccagagtacgaggacggccggggctttggcattggggagctggtgtgggggaaactg
cggggcttctcctggtggccaggccgcattgtgtcttggtggatgacgggccggagccga
gcagctgaaggcacccgctgggtcatgtggttcggagacggcaaattctcagtggtgtgt
gttgagaagctgatgccgctgagctcgttttgcagtgcgttccaccaggccacgtacaac
aagcagcccatgtaccgcaaagccatctacgaggtcctgcaggtggccagcagccgcgcg
gggaagctgttcccggtgtgccacgacagcgatgagagtgacactgccaaggccgtggag
gtgcagaacaagcccatgattgaatgggccctggggggcttccagccttctggccctaag
ggcctggagccaccagaagaagagaagaatccctacaaagaagtgtacacggacatgtgg
gtggaacctgaggcagctgcctacgcaccacctccaccagccaaaaagccccggaagagc
acagcggagaagcccaaggtcaaggagattattgatgagcgcacaagagagcggctggtg
tacgaggtgcggcagaagtgccggaacattgaggacatctgcatctcctgtgggagcctc
aatgttaccctggaacaccccctcttcgttggaggaatgtgccaaaactgcaagaactgc
tttctggagtgtgcgtaccagtacgacgacgacggctaccagtcctactgcaccatctgc
tgtgggggccgtgaggtgctcatgtgcggaaacaacaactgctgcaggtgcttttgcgtg
gagtgtgtggacctcttggtggggccgggggctgcccaggcagccattaaggaagacccc
tggaactgctacatgtgcgggcacaagggtacctacgggctgctgcggcggcgagaggac
tggccctcccggctccagatgttcttcgctaataaccacgaccaggaatttgaccctcca
aaggtttacccacctgtcccagctgagaagaggaagcccatccgggtgctgtctctcttt
gatggaatcgctacagggctcctggtgctgaaggacttgggcattcaggtggaccgctac
attgcctcggaggtgtgtgaggactccatcacggtgggcatggtgcggcaccaggggaag
atcatgtacgtcggggacgtccgcagcgtcacacagaagcatatccaggagtggggccca
ttcgatctggtgattgggggcagtccctgcaatgacctctccatcgtcaaccctgctcgc
aagggcctctacgagggcactggccggctcttctttgagttctaccgcctcctgcatgat
gcgcggcccaaggagggagatgatcgccccttcttctggctctttgagaatgtggtggcc
atgggcgttagtgacaagagggacatctcgcgatttctcgagtccaaccctgtgatgatt
gatgccaaagaagtgtcagctgcacacagggcccgctacttctggggtaaccttcccggt
atgaacaggccgttggcatccactgtgaatgataagctggagctgcaggagtgtctggag
catggcaggatagccaagttcagcaaagtgaggaccattactacgaggtcaaactccata
aagcagggcaaagaccagcattttcctgtcttcatgaatgagaaagaggacatcttatgg
tgcactgaaatggaaagggtatttggtttcccagtccactatactgacgtctccaacatg
agccgcttggcgaggcagagactgctgggccggtcatggagcgtgccagtcatccgccac
ctcttcgctccgctgaaggagtattttgcgtgtgtgtaa

DBGET integrated database retrieval system