KEGG   Homo sapiens (human): 1789Help
Entry
1789              CDS       T01001                                 

Gene name
DNMT3B, ICF, ICF1, M.HsaIIIB
Definition
DNA (cytosine-5-)-methyltransferase 3 beta (EC:2.1.1.37)
Orthology
K17399  
DNA (cytosine-5)-methyltransferase 3B [EC:2.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
MicroRNAs in cancer
Module
Methionine degradation
Disease
H00087  
Other humoral immunodeficiencies
Drug target
Azacitidine: 
Decitabine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    1789 (DNMT3B)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    1789 (DNMT3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     1789 (DNMT3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.2
AA seq 728 aa AA seqDB search
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREV
SSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPASLRRRATASAGTPWPSPP
SSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKE
FGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGL
FSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKP
TGIEGLKPNNTQPENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMAS
DVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCC
EGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDW
NVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYV
ASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARK
GLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMID
AIKVSAAHRARYFWGNLPGMNRIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAP
LKDYFACE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagacaccaggcatctcaatggagaggaggacgccggcgggagggaagactcg
atcctcgtcaacggggcctgcagcgaccagtcctccgactcgcccccaatcctggaggct
atccgcaccccggagatcagaggccgaagatcaagctcgcgactctccaagagggaggtg
tccagtctgctaagctacacacaggacttgacaggcgatggcgacggggaagatggggat
ggctctgacaccccagtcatgccaaagctcttccgggaaaccaggactcgttcagaaagc
ccagcttccctgagacggcgggcaacagcatcggcaggaacgccatggccgtcccctccc
agctcttaccttaccatcgacctcacagacgacacagaggacacacatgggacgccccag
agcagcagtaccccctacgcccgcctagcccaggacagccagcaggggggcatggagtcc
ccgcaggtggaggcagacagtggagatggagacagttcagagtatcaggatgggaaggag
tttggaataggggacctcgtgtggggaaagatcaagggcttctcctggtggcccgccatg
gtggtgtcttggaaggccacctccaagcgacaggctatgtctggcatgcggtgggtccag
tggtttggcgatggcaagttctccgaggtctctgcagacaaactggtggcactggggctg
ttcagccagcactttaatttggccaccttcaataagctcgtctcctatcgaaaagccatg
taccatgctctggagaaagctagggtgcgagctggcaagaccttccccagcagccctgga
gactcattggaggaccagctgaagcccatgttggagtgggcccacgggggcttcaagccc
actgggatcgagggcctcaaacccaacaacacgcaaccagagaacaagactcgaagacgc
acagctgacgactcagccacctctgactactgccccgcacccaagcgcctcaagacaaat
tgctataacaacggcaaagaccgaggggatgaagatcagagccgagaacaaatggcttca
gatgttgccaacaacaagagcagcctggaagatggctgtttgtcttgtggcaggaaaaac
cccgtgtccttccaccctctctttgagggggggctctgtcagacatgccgggatcgcttc
cttgagctgttttacatgtatgatgacgatggctatcagtcttactgcactgtgtgctgc
gagggccgagagctgctgctttgcagcaacacgagctgctgccggtgtttctgtgtggag
tgcctggaggtgctggtgggcacaggcacagcggccgaggccaagcttcaggagccctgg
agctgttacatgtgtctcccgcagcgctgtcatggcgtcctgcggcgccggaaggactgg
aacgtgcgcctgcaggccttcttcaccagtgacacggggcttgaatatgaagcccccaag
ctgtaccctgccattcccgcagcccgaaggcggcccattcgagtcctgtcattgtttgat
ggcatcgcgacaggctacctagtcctcaaagagttgggcataaaggtaggaaagtacgtc
gcttctgaagtgtgtgaggagtccattgctgttggaaccgtgaagcacgaggggaatatc
aaatacgtgaacgacgtgaggaacatcacaaagaaaaatattgaagaatggggcccattt
gacttggtgattggcggaagcccatgcaacgatctctcaaatgtgaatccagccaggaaa
ggcctgtatgagggtacaggccggctcttcttcgaattttaccacctgctgaattactca
cgccccaaggagggtgatgaccggccgttcttctggatgtttgagaatgttgtagccatg
aaggttggcgacaagagggacatctcacggttcctggagtgtaatccagtgatgattgat
gccatcaaagtttctgctgctcacagggcccgatacttctggggcaacctacccgggatg
aacaggatctttggctttcctgtgcactacacagacgtgtccaacatgggccgtggtgcc
cgccagaagctgctgggaaggtcctggagcgtgcctgtcatccgacacctcttcgcccct
ctgaaggactactttgcatgtgaatag

DBGET integrated database retrieval system