KEGG   Homo sapiens (human): 1791Help
Entry
1791              CDS       T01001                                 

Gene name
DNTT, TDT
Definition
DNA nucleotidylexotransferase (EC:2.7.7.31)
Orthology
K00977  
DNA nucleotidylexotransferase [EC:2.7.7.31]
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Hematopoietic cell lineage
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:hsa03450]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23-q24
AA seq 508 aa AA seqDB search
MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG
FRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMT
GKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE
FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAV
LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV
SCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQL
LQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS
WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRFERDLRRYATHERKMILDNHALYDKTK
RIFLKAESEEEIFAHLGLDYIEPWERNA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggatccaccacgagcgtcccacttgagccctcggaagaagagaccccggcagacgggt
gccttgatggcctcctctcctcaagacatcaaatttcaagatttggtcgtcttcattttg
gagaagaaaatgggaaccacccgcagagcgttcctcatggagctggcccgcaggaaaggg
ttcagggttgaaaatgagctcagtgattctgtcacccacatcgtagcagagaacaactcg
ggttcggatgttctggagtggcttcaagcacagaaagtacaagtcagctcacaaccagag
ctcctcgatgtctcctggctgatcgaatgcataagagcagggaaaccggtggaaatgaca
ggaaaacaccagcttgttgtgagaagagactattcagatagcaccaacccaggccccccg
aagactccaccaattgctgtacaaaagatctcccagtatgcgtgtcagagaagaaccact
ttaaacaactgtaaccagatattcacggatgcctttgatatactggctgaaaactgtgag
tttagagaaaatgaagactcctgtgtgacatttatgagagcagcttctgtattgaaatct
ctgccattcacaatcatcagtatgaaggacacagaaggaattccctgcctggggtccaag
gtgaagggtatcatagaggagattattgaagatggagaaagttctgaagttaaagctgtg
ttaaatgatgaacgatatcaatccttcaaactctttacttctgtatttggagtggggctg
aagacttctgagaagtggttcaggatgggtttcagaactctgagtaaagtaaggtcggac
aaaagcctgaaatttacacgaatgcagaaagcaggatttctgtattatgaagaccttgtc
agctgtgtgaccagggcagaagcagaggccgtcagtgtgctggttaaagaggctgtctgg
gcatttcttccggatgctttcgtcaccatgacaggagggttccggaggggtaagaagatg
gggcatgatgtagattttttaattaccagcccaggatcaacagaggatgaagagcaactt
ttacagaaagtgatgaacttatgggaaaagaagggattacttttatattatgaccttgtg
gagtcaacatttgaaaagctcaggttgcctagcaggaaggttgatgctttggatcatttt
caaaagtgctttctgattttcaaattgcctcgtcaaagagtggacagtgaccagtccagc
tggcaggaaggaaagacctggaaggccatccgtgtggatttagttctgtgcccctacgag
cgtcgtgcctttgccctgttgggatggactggctcccggtttgagagagacctccggcgc
tatgccacacatgagcggaagatgattctggataaccatgctttatatgacaagaccaag
aggatattcctcaaagcagaaagtgaagaagaaatttttgcgcatctgggattggattat
attgaaccgtgggaaagaaatgcctag

DBGET integrated database retrieval system