KEGG   Homo sapiens (human): 1791Help
Entry
1791              CDS       T01001                                 

Gene name
DNTT, TDT
Definition
DNA nucleotidylexotransferase (EC:2.7.7.31)
Orthology
K00977  
DNA nucleotidylexotransferase [EC:2.7.7.31]
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    1791 (DNTT)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1791 (DNTT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.31  DNA nucleotidylexotransferase
     1791 (DNTT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23-q24
AA seq 508 aa AA seqDB search
MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKG
FRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMT
GKHQLVVRRDYSDSTNPGPPKTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCE
FRENEDSCVTFMRAASVLKSLPFTIISMKDTEGIPCLGSKVKGIIEEIIEDGESSEVKAV
LNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSDKSLKFTRMQKAGFLYYEDLV
SCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITSPGSTEDEEQL
LQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS
WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRFERDLRRYATHERKMILDNHALYDKTK
RIFLKAESEEEIFAHLGLDYIEPWERNA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggatccaccacgagcgtcccacttgagccctcggaagaagagaccccggcagacgggt
gccttgatggcctcctctcctcaagacatcaaatttcaagatttggtcgtcttcattttg
gagaagaaaatgggaaccacccgcagagcgttcctcatggagctggcccgcaggaaaggg
ttcagggttgaaaatgagctcagtgattctgtcacccacatcgtagcagagaacaactcg
ggttcggatgttctggagtggcttcaagcacagaaagtacaagtcagctcacaaccagag
ctcctcgatgtctcctggctgatcgaatgcataagagcagggaaaccggtggaaatgaca
ggaaaacaccagcttgttgtgagaagagactattcagatagcaccaacccaggccccccg
aagactccaccaattgctgtacaaaagatctcccagtatgcgtgtcagagaagaaccact
ttaaacaactgtaaccagatattcacggatgcctttgatatactggctgaaaactgtgag
tttagagaaaatgaagactcctgtgtgacatttatgagagcagcttctgtattgaaatct
ctgccattcacaatcatcagtatgaaggacacagaaggaattccctgcctggggtccaag
gtgaagggtatcatagaggagattattgaagatggagaaagttctgaagttaaagctgtg
ttaaatgatgaacgatatcaatccttcaaactctttacttctgtatttggagtggggctg
aagacttctgagaagtggttcaggatgggtttcagaactctgagtaaagtaaggtcggac
aaaagcctgaaatttacacgaatgcagaaagcaggatttctgtattatgaagaccttgtc
agctgtgtgaccagggcagaagcagaggccgtcagtgtgctggttaaagaggctgtctgg
gcatttcttccggatgctttcgtcaccatgacaggagggttccggaggggtaagaagatg
gggcatgatgtagattttttaattaccagcccaggatcaacagaggatgaagagcaactt
ttacagaaagtgatgaacttatgggaaaagaagggattacttttatattatgaccttgtg
gagtcaacatttgaaaagctcaggttgcctagcaggaaggttgatgctttggatcatttt
caaaagtgctttctgattttcaaattgcctcgtcaaagagtggacagtgaccagtccagc
tggcaggaaggaaagacctggaaggccatccgtgtggatttagttctgtgcccctacgag
cgtcgtgcctttgccctgttgggatggactggctcccggtttgagagagacctccggcgc
tatgccacacatgagcggaagatgattctggataaccatgctttatatgacaagaccaag
aggatattcctcaaagcagaaagtgaagaagaaatttttgcgcatctgggattggattat
attgaaccgtgggaaagaaatgcctag

DBGET integrated database retrieval system