KEGG   Homo sapiens (human): 1793Help
Entry
1793              CDS       T01001                                 

Gene name
DOCK1, DOCK180, ced5
Definition
dedicator of cytokinesis 1
Orthology
K13708  
dedicator of cytokinesis protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1793 (DOCK1)
  Cellular commiunity
   04510 Focal adhesion
    1793 (DOCK1)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    1793 (DOCK1)
   05100 Bacterial invasion of epithelial cells
    1793 (DOCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.13-q26.3
AA seq 1886 aa AA seqDB search
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPLALDDAI
RHKPLNMSSRFSPRVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEF
PHLVDRTTAVARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDG
KRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQ
DSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEE
KGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQL
MKVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLE
TYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQL
YENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSK
MFTEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEA
CCQLLSHILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAIL
RQMEDYHYAHLIKTFGKMRTDVVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRA
INQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMR
RQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTR
SFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLME
RLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYT
LLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKE
LAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIY
RGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHR
PVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEV
KSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFA
NYEKAFFTDRYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEA
CFKQLKEKVEKEYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTP
SRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDI
SLQQSEAVILSETISPLRPQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSF
SMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPP
LPSKTPPPPPPKTTRKQTSVDSGIVQ
NT seq 5661 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgctgggtgcccaccaagcgcgaggagaagtacggcgtggctttttataactat
gatgccagaggagcggatgaactttctttacagatcggagacactgtgcacatcttagaa
acatatgaagggtggtaccgaggttacacgttacgaaaaaagtctaagaagggtatattt
cctgcttcatatattcatcttaaagaagcgatagttgaaggaaaagggcaacatgaaaca
gtcatcccgggtgacctccccctcatccaggaagtcaccacgacactccgagagtggtcc
accatctggaggcagctctacgtgcaagataacagggagatgtttcgaagtgtgcggcac
atgatctatgaccttattgaatggcgatcacaaattctttctggaactctgcctcaggat
gaactcaaagaactgaagaagaaggtcacagccaaaattgattatggaaacagaattcta
gatttggacctggtggttagagatgaagatgggaatattttggatccagaattaactagc
acgattagtctcttcagagctcatgaaatagcttctaaacaagtggaggaaaggttacaa
gaggaaaaatctcaaaagcagaacatagatattaacagacaagccaagtttgctgcaacc
ccttctctggccttgtttgtgaacctcaaaaatgtggtttgtaaaataggagaagatgct
gaagtcctcatgtctctatatgaccctgtggagtccaaattcatcagtgagaactacctg
gttcgctggtccagttcaggattacctaaagacatagacagattacataatttgcgagcc
gtgtttactgacctcggaagcaaagacctgaaaagggagaaaatcagttttgtctgtcag
attgttcgcgtgggtcgcatggagctgagggacaacaacaccaggaaactgacctcgggg
ttgcggcgaccttttggagtggctgtgatggatgtaacagatataataaatggaaaagta
gatgatgaagataagcagcatttcattccctttcagccgctcgcgttggacgacgccatt
cgacacaagccgctgaacatgtcatcccgtttttcacccagggtggcaggggagaatgac
ttccttcagactgttataaacaaagtcatcgctgccaaagaagtcaaccacaaggggcag
ggtttgtgggtaacattgaaattacttcctggagatatccatcagatccgaaaagagttt
ccgcatttagtggacaggaccacagctgtggctcgaaaaacagggtttccggagataatc
atgcctggtgatgttcgaaatgatatctatgtaacattagttcaaggagattttgataaa
ggaagcaaaacaacagcgaagaacgtggaggtcacggtgtctgtgtacgatgaggatggg
aaacgattagagcatgtgattttcccgggtgctggtgatgaagcgatttcagagtacaaa
tctgtgatttactaccaagtaaagcagccacgctggtttgagactgttaaggtggccatt
cccatcgaggacgttaaccgcagtcaccttcggtttaccttccgccacaggtcatcacag
gactctaaggataaatctgagaaaatatttgcactagcatttgtcaagctgatgagatac
gatggtaccaccctgcgagacggagagcacgatcttatcgtctataaggccgaagcaaag
aagctggaagatgctgccacgtacttgagtctgccctccacgaaggcagagttggaagaa
aagggccactcggccaccggcaagagcatgcagagccttgggagctgcaccattagcaag
gactccttccagatctccacgctcgtgtgctccaccaaactgactcagaacgtggacctt
ctggggctcttgaaatggcgctccaacaccagcctgctgcagcagaacttgaggcagctg
atgaaagtcgatggtggtgaagtagtgaagtttcttcaggacacgttggatgccctcttc
aacatcatgatggagaactcagagagtgagacttttgacacgttagtctttgatgctctg
gtatttatcattggactgattgctgatagaaaatttcagcattttaatcctgttttggaa
acttacattaagaaacactttagtgcaacgttagcctacacgaagttgacaaaagtgttg
aagaactacgtggacggtgctgagaagccgggagtaaatgagcagctgtacaaagccatg
aaagcgctagaatccatcttcaagttcatcgtgcgctccaggatcctgttcaatcaactg
tatgaaaacaagggagaggctgacttcgtggaatctttgctgcagctcttcaggtccatc
aatgacatgatgagcagcatgtcagaccagaccgtccgggtgaagggggcagcactgaaa
tacttaccaacgatcgtcaacgatgtgaaattggtgtttgatcccaaagagctcagcaaa
atgtttactgaattcatcctcaatgttcccatgggcttgctgaccatccagaaactctac
tgcttgatcgaaatcgtccacagtgacctcttcacacagcatgactgcagagagatcctg
cttcccatgatgaccgatcagctcaagtaccatctggagagacaggaggacctggaggcc
tgctgtcagctgctcagccacatcctggaggtgctgtacaggaaggacgtggggccaacc
cagaggcacgtccagattatcatggagaaacttctccggaccgtgaaccgaaccgtcatt
tccatgggacgagattctgaactcattggaaacttcgtggcttgcatgacagctatttta
cgacaaatggaagattaccattatgcccacttgatcaagacttttgggaaaatgaggact
gatgtggtagatttcctaatggaaacattcatcatgtttaagaacctcattggaaagaac
gtttaccccttcgactgggtgatcatgaacatggtgcaaaataaagtcttcctgcgagca
attaatcagtatgcagatatgctgaacaaaaaatttctggatcaagccaactttgagcta
cagctgtggaacaactactttcacctggctgttgctttccttactcaagagtccctgcaa
ctggagaatttttcaagtgccaagagagccaaaatccttaacaagtacggagatatgagg
agacagattggctttgaaatcagagacatgtggtacaaccttggtcaacacaagataaag
ttcattccagaaatggtgggcccaatattagaaatgacattaattcccgagacggagctg
cgcaaagccaccatccccatcttctttgatatgatgcagtgtgaattccattcgacccga
agcttccaaatgtttgaaaatgagatcatcaccaagctggatcatgaagtcgaaggaggc
agaggagacgaacagtacaaagtgttatttgataaaatccttctggaacactgcaggaag
cacaaatacctcgccaaaacaggagaaacttttgtaaaactcgttgtgcgcttaatggaa
aggcttttggattatagaaccatcatgcacgacgagaacaaagaaaaccgcatgagctgc
accgtcaatgtgctgaatttctacaaagaaattgaaagagaagaaatgtatataaggtat
ttgtacaagctctgtgacctgcacaaggagtgtgataactacaccgaagcggcttacacc
ttgcttctccatgcaaagcttcttaagtggtcggaggatgtgtgtgtggcccacctcacc
cagcgggacgggtaccaggccaccacgcagggacagctgaaggagcagctctaccaggaa
atcatccactacttcgacaaaggcaagatgtgggaggaggccattgccttgggcaaggag
ctagccgagcagtatgagaacgaaatgtttgattatgagcaactcagcgaattgctgaaa
aaacaggctcagttttatgaaaacatcgtcaaagtgatcaggcccaagcctgactatttt
gctgttggctactacggacaagggttccccacattcctgcggggaaaagttttcatttac
cgagggaaagagtatgagcgccgggaagattttgaggctcggctcttaactcagtttcca
aacgccgagaaaatgaagacaacatctccaccaggcgacgatattaaaaactctcctggc
cagtatattcagtgcttcacagtgaagcccaaactcgatctgcctcctaagtttcacagg
ccagtgtcagagcagattgtaagtttttacagggtgaacgaggtccagcgatttgaatat
tctcggccaatccggaagggagagaaaaacccagacaatgaatttgcgaatatgtggatc
gagagaaccatatatacaactgcatataaattacctggaattttaaggtggtttgaggtc
aagtctgttttcatggtggaaatcagccccctggagaatgccattgagaccatgcagctg
acgaacgacaagatcaacagcatggtgcagcagcacctggatgaccccagcctgcccatc
aacccgctctccatgctcctgaacggcatcgtggacccagctgtcatggggggcttcgca
aactacgaaaaggccttctttacagaccggtacctgcaggagcaccctgaggcccatgaa
aagatcgagaagctcaaggacctgattgcttggcagattccttttctggccgaagggatc
agaatccatggagacaaagtcacggaggcactgaggccgttccacgagaggatggaggcc
tgtttcaaacagctgaaggaaaaggtggagaaagagtacggcgtccgaatcatgccctca
agtctggatgatagaagaggcagccgcccccggtccatggtgcggtccttcacgatgcct
tcctcatcccgccctctgtctgtggcctctgtctcttccctctcatcggacagcacccct
tccagaccaggctccgacgggtttgccctggagcctctcctgccaaagaaaatgcactcc
aggtcccaggacaagctggacaaggatgacctggagaaggagaagaaggacaagaagaag
gaaaaaaggaacagcaaacatcaagagatatttgagaaagaatttaaacccaccgacatt
tccctgcagcagtctgaggctgtgatcctttcggaaacgataagtcccctgcggccccag
agaccgaagagccaggtgatgaacgtcattggaagcgaaaggcgcttctcggtgtccccc
tcgtcaccgtcctcccagcaaacaccccctccagttacaccaagggccaagctcagcttc
agcatgcagtcgagcttggagctgaacggcatgacgggggcggacgtggccgatgtccca
ccccctctgcctctcaaaggcagcgtggcagattacgggaatttgatggaaaaccaggac
ttgctgggctcgccaacacctccacctccccctccacaccagaggcatctgccacctcca
ctgcccagcaaaactccgcctcctccccctccaaagacaactcgcaagcagacatcggtg
gactccgggatcgtgcagtga

DBGET integrated database retrieval system