KEGG   Homo sapiens (human): 1793Help
Entry
1793              CDS       T01001                                 

Gene name
DOCK1, DOCK180, ced5
Definition
dedicator of cytokinesis 1
Orthology
K13708  
dedicator of cytokinesis protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.13-q26.3
AA seq 1865 aa AA seqDB search
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLK
NYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSIN
DMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSHILEVLYRKDVGPTQ
RHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQ
RDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEK
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSS
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQR
PKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPP
PLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVD
SGIVQ
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgctgggtgcccaccaagcgcgaggagaagtacggcgtggctttttataactat
gatgccagaggagcggatgaactttctttacagatcggagacactgtgcacatcttagaa
acatatgaagggtggtaccgaggttacacgttacgaaaaaagtctaagaagggtatattt
cctgcttcatatattcatcttaaagaagcgatagttgaaggaaaagggcaacatgaaaca
gtcatcccgggtgacctccccctcatccaggaagtcaccacgacactccgagagtggtcc
accatctggaggcagctctacgtgcaagataacagggagatgtttcgaagtgtgcggcac
atgatctatgaccttattgaatggcgatcacaaattctttctggaactctgcctcaggat
gaactcaaagaactgaagaagaaggtcacagccaaaattgattatggaaacagaattcta
gatttggacctggtggttagagatgaagatgggaatattttggatccagaattaactagc
acgattagtctcttcagagctcatgaaatagcttctaaacaagtggaggaaaggttacaa
gaggaaaaatctcaaaagcagaacatagatattaacagacaagccaagtttgctgcaacc
ccttctctggccttgtttgtgaacctcaaaaatgtggtttgtaaaataggagaagatgct
gaagtcctcatgtctctatatgaccctgtggagtccaaattcatcagtgagaactacctg
gttcgctggtccagttcaggattacctaaagacatagacagattacataatttgcgagcc
gtgtttactgacctcggaagcaaagacctgaaaagggagaaaatcagttttgtctgtcag
attgttcgcgtgggtcgcatggagctgagggacaacaacaccaggaaactgacctcgggg
ttgcggcgaccttttggagtggctgtgatggatgtaacagatataataaatggaaaagta
gatgatgaagataagcagcatttcattccctttcagccggtggcaggggagaatgacttc
cttcagactgttataaacaaagtcatcgctgccaaagaagtcaaccacaaggggcagggt
ttgtgggtaacattgaaattacttcctggagatatccatcagatccgaaaagagtttccg
catttagtggacaggaccacagctgtggctcgaaaaacagggtttccggagataatcatg
cctggtgatgttcgaaatgatatctatgtaacattagttcaaggagattttgataaagga
agcaaaacaacagcgaagaacgtggaggtcacggtgtctgtgtacgatgaggatgggaaa
cgattagagcatgtgattttcccgggtgctggtgatgaagcgatttcagagtacaaatct
gtgatttactaccaagtaaagcagccacgctggtttgagactgttaaggtggccattccc
atcgaggacgttaaccgcagtcaccttcggtttaccttccgccacaggtcatcacaggac
tctaaggataaatctgagaaaatatttgcactagcatttgtcaagctgatgagatacgat
ggtaccaccctgcgagacggagagcacgatcttatcgtctataaggccgaagcaaagaag
ctggaagatgctgccacgtacttgagtctgccctccacgaaggcagagttggaagaaaag
ggccactcggccaccggcaagagcatgcagagccttgggagctgcaccattagcaaggac
tccttccagatctccacgctcgtgtgctccaccaaactgactcagaacgtggaccttctg
gggctcttgaaatggcgctccaacaccagcctgctgcagcagaacttgaggcagctgatg
aaagtcgatggtggtgaagtagtgaagtttcttcaggacacgttggatgccctcttcaac
atcatgatggagaactcagagagtgagacttttgacacgttagtctttgatgctctggta
tttatcattggactgattgctgatagaaaatttcagcattttaatcctgttttggaaact
tacattaagaaacactttagtgcaacgttagcctacacgaagttgacaaaagtgttgaag
aactacgtggacggtgctgagaagccgggagtaaatgagcagctgtacaaagccatgaaa
gcgctagaatccatcttcaagttcatcgtgcgctccaggatcctgttcaatcaactgtat
gaaaacaagggagaggctgacttcgtggaatctttgctgcagctcttcaggtccatcaat
gacatgatgagcagcatgtcagaccagaccgtccgggtgaagggggcagcactgaaatac
ttaccaacgatcgtcaacgatgtgaaattggtgtttgatcccaaagagctcagcaaaatg
tttactgaattcatcctcaatgttcccatgggcttgctgaccatccagaaactctactgc
ttgatcgaaatcgtccacagtgacctcttcacacagcatgactgcagagagatcctgctt
cccatgatgaccgatcagctcaagtaccatctggagagacaggaggacctggaggcctgc
tgtcagctgctcagccacatcctggaggtgctgtacaggaaggacgtggggccaacccag
aggcacgtccagattatcatggagaaacttctccggaccgtgaaccgaaccgtcatttcc
atgggacgagattctgaactcattggaaacttcgtggcttgcatgacagctattttacga
caaatggaagattaccattatgcccacttgatcaagacttttgggaaaatgaggactgat
gtggtagatttcctaatggaaacattcatcatgtttaagaacctcattggaaagaacgtt
taccccttcgactgggtgatcatgaacatggtgcaaaataaagtcttcctgcgagcaatt
aatcagtatgcagatatgctgaacaaaaaatttctggatcaagccaactttgagctacag
ctgtggaacaactactttcacctggctgttgctttccttactcaagagtccctgcaactg
gagaatttttcaagtgccaagagagccaaaatccttaacaagtacggagatatgaggaga
cagattggctttgaaatcagagacatgtggtacaaccttggtcaacacaagataaagttc
attccagaaatggtgggcccaatattagaaatgacattaattcccgagacggagctgcgc
aaagccaccatccccatcttctttgatatgatgcagtgtgaattccattcgacccgaagc
ttccaaatgtttgaaaatgagatcatcaccaagctggatcatgaagtcgaaggaggcaga
ggagacgaacagtacaaagtgttatttgataaaatccttctggaacactgcaggaagcac
aaatacctcgccaaaacaggagaaacttttgtaaaactcgttgtgcgcttaatggaaagg
cttttggattatagaaccatcatgcacgacgagaacaaagaaaaccgcatgagctgcacc
gtcaatgtgctgaatttctacaaagaaattgaaagagaagaaatgtatataaggtatttg
tacaagctctgtgacctgcacaaggagtgtgataactacaccgaagcggcttacaccttg
cttctccatgcaaagcttcttaagtggtcggaggatgtgtgtgtggcccacctcacccag
cgggacgggtaccaggccaccacgcagggacagctgaaggagcagctctaccaggaaatc
atccactacttcgacaaaggcaagatgtgggaggaggccattgccttgggcaaggagcta
gccgagcagtatgagaacgaaatgtttgattatgagcaactcagcgaattgctgaaaaaa
caggctcagttttatgaaaacatcgtcaaagtgatcaggcccaagcctgactattttgct
gttggctactacggacaagggttccccacattcctgcggggaaaagttttcatttaccga
gggaaagagtatgagcgccgggaagattttgaggctcggctcttaactcagtttccaaac
gccgagaaaatgaagacaacatctccaccaggcgacgatattaaaaactctcctggccag
tatattcagtgcttcacagtgaagcccaaactcgatctgcctcctaagtttcacaggcca
gtgtcagagcagattgtaagtttttacagggtgaacgaggtccagcgatttgaatattct
cggccaatccggaagggagagaaaaacccagacaatgaatttgcgaatatgtggatcgag
agaaccatatatacaactgcatataaattacctggaattttaaggtggtttgaggtcaag
tctgttttcatggtggaaatcagccccctggagaatgccattgagaccatgcagctgacg
aacgacaagatcaacagcatggtgcagcagcacctggatgaccccagcctgcccatcaac
ccgctctccatgctcctgaacggcatcgtggacccagctgtcatggggggcttcgcaaac
tacgaaaaggccttctttacagaccggtacctgcaggagcaccctgaggcccatgaaaag
atcgagaagctcaaggacctgattgcttggcagattccttttctggccgaagggatcaga
atccatggagacaaagtcacggaggcactgaggccgttccacgagaggatggaggcctgt
ttcaaacagctgaaggaaaaggtggagaaagagtacggcgtccgaatcatgccctcaagt
ctggatgatagaagaggcagccgcccccggtccatggtgcggtccttcacgatgccttcc
tcatcccgccctctgtctgtggcctctgtctcttccctctcatcggacagcaccccttcc
agaccaggctccgacgggtttgccctggagcctctcctgccaaagaaaatgcactccagg
tcccaggacaagctggacaaggatgacctggagaaggagaagaaggacaagaagaaggaa
aaaaggaacagcaaacatcaagagatatttgagaaagaatttaaacccaccgacatttcc
ctgcagcagtctgaggctgtgatcctttcggaaacgataagtcccctgcggccccagaga
ccgaagagccaggtgatgaacgtcattggaagcgaaaggcgcttctcggtgtccccctcg
tcaccgtcctcccagcaaacaccccctccagttacaccaagggccaagctcagcttcagc
atgcagtcgagcttggagctgaacggcatgacgggggcggacgtggccgatgtcccaccc
cctctgcctctcaaaggcagcgtggcagattacgggaatttgatggaaaaccaggacttg
ctgggctcgccaacacctccacctccccctccacaccagaggcatctgccacctccactg
cccagcaaaactccgcctcctccccctccaaagacaactcgcaagcagacatcggtggac
tccgggatcgtgcagtga

DBGET integrated database retrieval system