KEGG   Homo sapiens (human): 1793Help
Entry
1793              CDS       T01001                                 

Gene name
DOCK1, DOCK180, ced5
Definition
(RefSeq) dedicator of cytokinesis 1
  KO
K13708  
dedicator of cytokinesis protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    1793 (DOCK1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    1793 (DOCK1)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    1793 (DOCK1)
   05100 Bacterial invasion of epithelial cells
    1793 (DOCK1)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    1793 (DOCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14185(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.2
AA seq 1865 aa AA seqDB search
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLK
NYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSIN
DMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSHILEVLYRKDVGPTQ
RHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQ
RDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEK
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSS
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQR
PKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPP
PLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVD
SGIVQ
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgctgggtgcccaccaagcgcgaggagaagtacggcgtggctttttataactat
gatgccagaggagcggatgaactttctttacagatcggagacactgtgcacatcttagaa
acatatgaagggtggtaccgaggttacacgttacgaaaaaagtctaagaagggtatattt
cctgcttcatatattcatcttaaagaagcgatagttgaaggaaaagggcaacatgaaaca
gtcatcccgggtgacctccccctcatccaggaagtcaccacgacactccgagagtggtcc
accatctggaggcagctctacgtgcaagataacagggagatgtttcgaagtgtgcggcac
atgatctatgaccttattgaatggcgatcacaaattctttctggaactctgcctcaggat
gaactcaaagaactgaagaagaaggtcacagccaaaattgattatggaaacagaattcta
gatttggacctggtggttagagatgaagatgggaatattttggatccagaattaactagc
acgattagtctcttcagagctcatgaaatagcttctaaacaagtggaggaaaggttacaa
gaggaaaaatctcaaaagcagaacatagatattaacagacaagccaagtttgctgcaacc
ccttctctggccttgtttgtgaacctcaaaaatgtggtttgtaaaataggagaagatgct
gaagtcctcatgtctctatatgaccctgtggagtccaaattcatcagtgagaactacctg
gttcgctggtccagttcaggattacctaaagacatagacagattacataatttgcgagcc
gtgtttactgacctcggaagcaaagacctgaaaagggagaaaatcagttttgtctgtcag
attgttcgcgtgggtcgcatggagctgagggacaacaacaccaggaaactgacctcgggg
ttgcggcgaccttttggagtggctgtgatggatgtaacagatataataaatggaaaagta
gatgatgaagataagcagcatttcattccctttcagccggtggcaggggagaatgacttc
cttcagactgttataaacaaagtcatcgctgccaaagaagtcaaccacaaggggcagggt
ttgtgggtaacattgaaattacttcctggagatatccatcagatccgaaaagagtttccg
catttagtggacaggaccacagctgtggctcgaaaaacagggtttccggagataatcatg
cctggtgatgttcgaaatgatatctatgtaacattagttcaaggagattttgataaagga
agcaaaacaacagcgaagaacgtggaggtcacggtgtctgtgtacgatgaggatgggaaa
cgattagagcatgtgattttcccgggtgctggtgatgaagcgatttcagagtacaaatct
gtgatttactaccaagtaaagcagccacgctggtttgagactgttaaggtggccattccc
atcgaggacgttaaccgcagtcaccttcggtttaccttccgccacaggtcatcacaggac
tctaaggataaatctgagaaaatatttgcactagcatttgtcaagctgatgagatacgat
ggtaccaccctgcgagacggagagcacgatcttatcgtctataaggccgaagcaaagaag
ctggaagatgctgccacgtacttgagtctgccctccacgaaggcagagttggaagaaaag
ggccactcggccaccggcaagagcatgcagagccttgggagctgcaccattagcaaggac
tccttccagatctccacgctcgtgtgctccaccaaactgactcagaacgtggaccttctg
gggctcttgaaatggcgctccaacaccagcctgctgcagcagaacttgaggcagctgatg
aaagtcgatggtggtgaagtagtgaagtttcttcaggacacgttggatgccctcttcaac
atcatgatggagaactcagagagtgagacttttgacacgttagtctttgatgctctggta
tttatcattggactgattgctgatagaaaatttcagcattttaatcctgttttggaaact
tacattaagaaacactttagtgcaacgttagcctacacgaagttgacaaaagtgttgaag
aactacgtggacggtgctgagaagccgggagtaaatgagcagctgtacaaagccatgaaa
gcgctagaatccatcttcaagttcatcgtgcgctccaggatcctgttcaatcaactgtat
gaaaacaagggagaggctgacttcgtggaatctttgctgcagctcttcaggtccatcaat
gacatgatgagcagcatgtcagaccagaccgtccgggtgaagggggcagcactgaaatac
ttaccaacgatcgtcaacgatgtgaaattggtgtttgatcccaaagagctcagcaaaatg
tttactgaattcatcctcaatgttcccatgggcttgctgaccatccagaaactctactgc
ttgatcgaaatcgtccacagtgacctcttcacacagcatgactgcagagagatcctgctt
cccatgatgaccgatcagctcaagtaccatctggagagacaggaggacctggaggcctgc
tgtcagctgctcagccacatcctggaggtgctgtacaggaaggacgtggggccaacccag
aggcacgtccagattatcatggagaaacttctccggaccgtgaaccgaaccgtcatttcc
atgggacgagattctgaactcattggaaacttcgtggcttgcatgacagctattttacga
caaatggaagattaccattatgcccacttgatcaagacttttgggaaaatgaggactgat
gtggtagatttcctaatggaaacattcatcatgtttaagaacctcattggaaagaacgtt
taccccttcgactgggtgatcatgaacatggtgcaaaataaagtcttcctgcgagcaatt
aatcagtatgcagatatgctgaacaaaaaatttctggatcaagccaactttgagctacag
ctgtggaacaactactttcacctggctgttgctttccttactcaagagtccctgcaactg
gagaatttttcaagtgccaagagagccaaaatccttaacaagtacggagatatgaggaga
cagattggctttgaaatcagagacatgtggtacaaccttggtcaacacaagataaagttc
attccagaaatggtgggcccaatattagaaatgacattaattcccgagacggagctgcgc
aaagccaccatccccatcttctttgatatgatgcagtgtgaattccattcgacccgaagc
ttccaaatgtttgaaaatgagatcatcaccaagctggatcatgaagtcgaaggaggcaga
ggagacgaacagtacaaagtgttatttgataaaatccttctggaacactgcaggaagcac
aaatacctcgccaaaacaggagaaacttttgtaaaactcgttgtgcgcttaatggaaagg
cttttggattatagaaccatcatgcacgacgagaacaaagaaaaccgcatgagctgcacc
gtcaatgtgctgaatttctacaaagaaattgaaagagaagaaatgtatataaggtatttg
tacaagctctgtgacctgcacaaggagtgtgataactacaccgaagcggcttacaccttg
cttctccatgcaaagcttcttaagtggtcggaggatgtgtgtgtggcccacctcacccag
cgggacgggtaccaggccaccacgcagggacagctgaaggagcagctctaccaggaaatc
atccactacttcgacaaaggcaagatgtgggaggaggccattgccttgggcaaggagcta
gccgagcagtatgagaacgaaatgtttgattatgagcaactcagcgaattgctgaaaaaa
caggctcagttttatgaaaacatcgtcaaagtgatcaggcccaagcctgactattttgct
gttggctactacggacaagggttccccacattcctgcggggaaaagttttcatttaccga
gggaaagagtatgagcgccgggaagattttgaggctcggctcttaactcagtttccaaac
gccgagaaaatgaagacaacatctccaccaggcgacgatattaaaaactctcctggccag
tatattcagtgcttcacagtgaagcccaaactcgatctgcctcctaagtttcacaggcca
gtgtcagagcagattgtaagtttttacagggtgaacgaggtccagcgatttgaatattct
cggccaatccggaagggagagaaaaacccagacaatgaatttgcgaatatgtggatcgag
agaaccatatatacaactgcatataaattacctggaattttaaggtggtttgaggtcaag
tctgttttcatggtggaaatcagccccctggagaatgccattgagaccatgcagctgacg
aacgacaagatcaacagcatggtgcagcagcacctggatgaccccagcctgcccatcaac
ccgctctccatgctcctgaacggcatcgtggacccagctgtcatggggggcttcgcaaac
tacgaaaaggccttctttacagaccggtacctgcaggagcaccctgaggcccatgaaaag
atcgagaagctcaaggacctgattgcttggcagattccttttctggccgaagggatcaga
atccatggagacaaagtcacggaggcactgaggccgttccacgagaggatggaggcctgt
ttcaaacagctgaaggaaaaggtggagaaagagtacggcgtccgaatcatgccctcaagt
ctggatgatagaagaggcagccgcccccggtccatggtgcggtccttcacgatgccttcc
tcatcccgccctctgtctgtggcctctgtctcttccctctcatcggacagcaccccttcc
agaccaggctccgacgggtttgccctggagcctctcctgccaaagaaaatgcactccagg
tcccaggacaagctggacaaggatgacctggagaaggagaagaaggacaagaagaaggaa
aaaaggaacagcaaacatcaagagatatttgagaaagaatttaaacccaccgacatttcc
ctgcagcagtctgaggctgtgatcctttcggaaacgataagtcccctgcggccccagaga
ccgaagagccaggtgatgaacgtcattggaagcgaaaggcgcttctcggtgtccccctcg
tcaccgtcctcccagcaaacaccccctccagttacaccaagggccaagctcagcttcagc
atgcagtcgagcttggagctgaacggcatgacgggggcggacgtggccgatgtcccaccc
cctctgcctctcaaaggcagcgtggcagattacgggaatttgatggaaaaccaggacttg
ctgggctcgccaacacctccacctccccctccacaccagaggcatctgccacctccactg
cccagcaaaactccgcctcctccccctccaaagacaactcgcaagcagacatcggtggac
tccgggatcgtgcagtga

DBGET integrated database retrieval system