KEGG   Homo sapiens (human): 1796Help
Entry
1796              CDS       T01001                                 

Gene name
DOK1, P62DOK
Definition
docking protein 1, 62kDa (downstream of tyrosine kinase 1)
Orthology
K14752  
docking protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Measles
Class
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p13
AA seq 342 aa AA seqDB search
MLENSLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLL
SWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKAG
QGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPL
DSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDL
PREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGS
GIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaactccttgtacagccctacctgggaaggatcccaattctgggtaacggtg
cagaggactgaggccgccgagcgctgtggcctgcatggctcctacgtgctgagggtggag
gctgaaaggctgactctcctgaccgtgggggcccagagtcagatactggagccactcctg
tcctggccctacactctgttgcgtcgctatggccgggacaaggtcatgttctctttcgag
gccggccgccgctgcccctcaggccctggaaccttcaccttccagacggcacagggaaat
gacatcttccaggcagttgagactgccatccaccggcagaaggcccagggaaaggccgga
caggggcacgatgttctcagagctgactcccatgaaggggaggtggcagaggggaagttg
ccttccccacctggcccccaagagctcctcgacagtcccccagccctgtatgctgagccc
ttagactccctgcgcattgctccatgcccttcccaggactccctatactcagaccccttg
gacagcacgtctgctcaggcaggagagggagtacaacggaagaaacctctctattgggac
ttgtatgagcatgcgcagcagcagttgctgaaggccaagctgacagaccccaaagaggat
cccatctatgatgaacctgagggcctggccccagtccctccccagggcctttatgatctg
cctcgggagcccaaggatgcatggtggtgccaagctcgggtgaaggaggagggctatgag
ctcccctacaaccctgccactgatgactacgctgtgccaccccctcggagcacaaagccc
ctccttgctcccaagccccagggcccagccttccctgaacctggtactgcaactggcagt
ggcatcaaaagccacaactcagccctgtacagccaggtccagaagagcggggcctcaggg
agctgggactgtgggctctctagagtagggactgacaagactggggtcaagtcagagggc
tctacctga

DBGET integrated database retrieval system