KEGG   Homo sapiens (human): 18Help
Entry
18                CDS       T01001                                 

Gene name
ABAT, GABA-AT, GABAT, NPD009
Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19 2.6.1.22)
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Module
GABA (gamma-Aminobutyrate) shunt
Disease
H01257  
GABA-transaminase deficiency
Drug target
Valproic acid: 
Vigabatrin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    18 (ABAT)
   00650 Butanoate metabolism
    18 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    18 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    18 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    18 (ABAT)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    18 (ABAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     18 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     18 (ABAT)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class III
   18 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.2
AA seq 500 aa AA seqDB search
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcgcccagcgcctggcctgcagcttccagcacagctaccgcctg
ctggtgcctggatccagacacattagtcaagctgcagccaaagtcgacgttgaatttgat
tatgatgggcctctgatgaagacggaagtcccagggcctagatctcaggagttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcattttttctgcaattacgaagagagc
cgaggcaattacctggttgatgtggacggcaaccgaatgctggatctttattcccagatc
tcctctgtccccataggttacagccaccccgccctgctgaaactcatccaacagcctcaa
aatgcgagcatgtttgtcaacagacccgccctcggaatcctgcctccggagaactttgtg
gagaagctccggcagtccttgctctcggtggctcccaaagggatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaacgccttaaagaccatcttcatgtggtaccgg
agcaaggaaagagggcagaggggcttctcccaggaggagctggagacgtgcatgattaac
caggcccctggctgccccgactacagcatcctctccttcatgggcgcgttccatgggagg
accatgggttgcttagcgaccacgcactctaaagccattcacaagatcgacatcccttcc
tttgactggcccatcgcaccgttcccacggctgaaataccctctggaagagtttgtgaaa
gagaaccaacaggaggaggcccgctgtctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaagaagacggtggccgggatcatcgtggagcccatccagtccgagggtgga
gacaaccacgcatccgatgacttctttcggaagctgagagacatcgccaggaagcatggc
tgcgccttcttggtggacgaggtccagaccggaggaggctgcacgggcaagttctgggcc
catgagcactggggcctggatgacccagcagacgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttcaggcctaatgctccctaccggatcttcaac
acctggctgggggacccgtccaagaacctgttgctggctgaggtcatcaacatcatcaag
cgggaggacctgctaaataatgcagcccatgccgggaaggccctgctcacaggactgctg
gacctccaggcccggtacccccagttcatcagcagggtgagaggacgaggcaccttttgc
tccttcgatactcccgatgattccatacggaataagctcattttaattgccagaaacaaa
ggtgtggtgttgggtggctgtggtgacaaatccattcgtttccgtcccacgctggtcttc
agggatcaccacgctcacctgttcctcaatattttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system