KEGG   Homo sapiens (human): 18Help
Entry
18                CDS       T01001                                 

Gene name
ABAT, GABA-AT, GABAT, NPD009
Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19 2.6.1.22)
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Module
GABA (gamma-Aminobutyrate) shunt
Disease
H01257  
GABA-transaminase deficiency
Drug target
Valproic acid: 
Vigabatrin: 
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsa00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hsa00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.2
AA seq 500 aa AA seqDB search
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcgcccagcgcctggcctgcagcttccagcacagctaccgcctg
ctggtgcctggatccagacacattagtcaagctgcagccaaagtcgacgttgaatttgat
tatgatgggcctctgatgaagacggaagtcccagggcctagatctcaggagttaatgaaa
cagctgaatataattcagaatgcagaggctgtgcattttttctgcaattacgaagagagc
cgaggcaattacctggttgatgtggacggcaaccgaatgctggatctttattcccagatc
tcctctgtccccataggttacagccaccccgccctgctgaaactcatccaacagcctcaa
aatgcgagcatgtttgtcaacagacccgccctcggaatcctgcctccggagaactttgtg
gagaagctccggcagtccttgctctcggtggctcccaaagggatgtcccagctcatcacc
atggcctgcggctcctgctccaatgaaaacgccttaaagaccatcttcatgtggtaccgg
agcaaggaaagagggcagaggggcttctcccaggaggagctggagacgtgcatgattaac
caggcccctggctgccccgactacagcatcctctccttcatgggcgcgttccatgggagg
accatgggttgcttagcgaccacgcactctaaagccattcacaagatcgacatcccttcc
tttgactggcccatcgcaccgttcccacggctgaaataccctctggaagagtttgtgaaa
gagaaccaacaggaggaggcccgctgtctggaagaggtggaggatctgattgtgaaatat
cggaaaaagaagaagacggtggccgggatcatcgtggagcccatccagtccgagggtgga
gacaaccacgcatccgatgacttctttcggaagctgagagacatcgccaggaagcatggc
tgcgccttcttggtggacgaggtccagaccggaggaggctgcacgggcaagttctgggcc
catgagcactggggcctggatgacccagcagacgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttcaggcctaatgctccctaccggatcttcaac
acctggctgggggacccgtccaagaacctgttgctggctgaggtcatcaacatcatcaag
cgggaggacctgctaaataatgcagcccatgccgggaaggccctgctcacaggactgctg
gacctccaggcccggtacccccagttcatcagcagggtgagaggacgaggcaccttttgc
tccttcgatactcccgatgattccatacggaataagctcattttaattgccagaaacaaa
ggtgtggtgttgggtggctgtggtgacaaatccattcgtttccgtcccacgctggtcttc
agggatcaccacgctcacctgttcctcaatattttcagtgacatcttagcagacttcaag
taa

DBGET integrated database retrieval system