KEGG   Homo sapiens (human): 1800Help
Entry
1800              CDS       T01001                                 

Gene name
DPEP1, MBD1, MDP, RDP
Definition
(RefSeq) dipeptidase 1 (renal) (EC:3.4.13.19)
  KO
K01273  
membrane dipeptidase [EC:3.4.13.19]
Organism
hsa  Homo sapiens (human)
Drug target
Cilastatin (DG01397): 
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.19  membrane dipeptidase
     1800 (DPEP1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M19: membrane dipeptidase family
   1800 (DPEP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1800 (DPEP1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  1800 (DPEP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q24.3
AA seq 411 aa AA seqDB search
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTT
LAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVT
SSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLV
DTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYS
VCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLT
QAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcggatggtggctgtggccccttgtggccgtctgcactgcagacttctttcgg
gacgaggcagagaggatcatgagggactcccctgtcattgatgggcacaatgacctcccc
tggcagctgctggatatgttcaacaaccggctgcaggacgagagggccaacctgaccacc
ttggccggcacacacaccaacatccccaagctgagggccggctttgtgggaggccagttc
tggtccgtgtacacgccctgcgacacccagaacaaagacgccgtgcggaggacgctggag
cagatggacgtggtccaccgcatgtgccggatgtacccggagaccttcctgtatgtcacc
agcagtgcaggcattcggcaggccttccgggaagggaaggtggccagcctgatcggcgtg
gagggcggccactccattgacagcagtttgggcgtcctgcgggcactctatcagctgggc
atgcggtacctgaccctcacccacagctgcaacacgccctgggctgacaactggctggtg
gacacgggagacagcgagccccagagccaaggcttgtcaccctttgggcagcgtgtggtg
aaggagctgaaccgtctgggggtcctcatcgacttggctcacgtgtctgtggccaccatg
aaggccaccctgcagctgtccagagccccggtcatcttcagccactcctcggcctacagc
gtgtgcgcaagccggcgcaacgtgcctgacgacgtcctgaggctggtgaaacagacagac
agcctggtgatggtgaacttctacaacaattacatttcctgcaccaacaaggccaacctg
tcccaagtggccgaccatctggatcacatcaaggaggtggcaggagccagagccgtgggt
tttggtggggactttgatggtgttccaagggtccctgaggggctggaggacgtctccaag
tatccagacctgatcgctgagctgctcaggaggaactggacggaggcggaggtcaagggc
gcactggctgacaacctgctgagggtcttcgaggctgtggaacaggccagcaacctcaca
caggctcccgaggaggagcccatcccgctggaccagctgggtggctcctgcaggacccat
tacggctactcctctggggcttccagcctccatcgccactgggggctcctgctggcctcc
ctcgctcccctggtcctctgtctgtctctcctgtga

DBGET integrated database retrieval system